DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and pof1

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_593310.1 Gene:pof1 / 2542914 PomBaseID:SPAC57A10.05c Length:605 Species:Schizosaccharomyces pombe


Alignment Length:414 Identity:91/414 - (21%)
Similarity:163/414 - (39%) Gaps:81/414 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SKTNIEPLADRILLQTLAEAEEEQSP---ADLEKSPPPRPVSGSVARSQNAFSALKQALEKLQKK 99
            :|.:|:...:|:..:.:.:| .|.||   |.|:..|        .:.::...|::|........|
pombe   180 AKASIQKRYERLTKRGVDQA-HESSPVKKAKLDDYP--------TSSNEETISSVKPPSPNSDSK 235

  Fly   100 LREPVK----KKFYLHKCH----------NSHILPLTNVSFDRSGERCL--------TGSYDRTC 142
            ...|.|    |:.|..:|.          ...:|     |....|..||        :||||.|.
pombe   236 FFLPFKTRPWKEVYAERCRVECNWRHGRCRQVVL-----SGHSDGVMCLQLVRNILASGSYDATI 295

  Fly   143 HVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAK 207
            .:.|..|.|...:|.||.:.|..:.|:                        ..|:::||.|.|.:
pombe   296 RLWNLATFQQVALLEGHSSGVTCLQFD------------------------QCKLISGSMDKTIR 336

  Fly   208 VWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIA 272
            :|:..:.:.:...:|||..::...|   |...:.:.|.|.:.:::.......: .|..|...|.:
pombe   337 IWNYRTSECISILHGHTDSVLCLTF---DSTLLVSGSADCTVKLWHFSGGKRI-TLRGHTGPVNS 397

  Fly   273 ARFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWD 337
            .|..||..::|:||.|.:..||.:.:.:..|....|...:.:..  .:.|.:.:.|||.|.:.||
pombe   398 VRIIRDRGLVLSGSDDSTIKIWSLETNTCLHTFSAHIGPVQSLA--LADSRLFSCSLDGTIKQWD 460

  Fly   338 TRKLDQELYLAARHSDEVLDVSFDAAGQL-LATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVS 401
            ..| .:.::....|.:.|.::   ||..| |.:.:.|...:||     ...|.:..:..||:.|:
pombe   461 IEK-KKCVHTLFGHIEGVWEI---AADHLRLISGAHDGVVKVW-----EACECVHTLKNHSEPVT 516

  Fly   402 KVCFSPSGCMLLTASADNTARLWL 425
            .|..  ..|.:::.|.|....|||
pombe   517 SVAL--GDCEVVSGSEDGKIYLWL 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 79/356 (22%)
WD40 repeat 122..158 CDD:293791 13/43 (30%)
WD40 154..467 CDD:238121 60/273 (22%)
WD40 repeat 189..222 CDD:293791 6/32 (19%)
WD40 repeat 228..265 CDD:293791 5/36 (14%)
WD40 repeat 270..306 CDD:293791 11/35 (31%)
WD40 repeat 314..348 CDD:293791 8/33 (24%)
WD40 repeat 355..393 CDD:293791 9/38 (24%)
WD40 repeat 400..436 CDD:293791 8/26 (31%)
WD40 repeat 442..466 CDD:293791
pof1NP_593310.1 F-box-like 110..156 CDD:289689
WD40 <258..564 CDD:225201 73/327 (22%)
WD40 268..537 CDD:238121 70/314 (22%)
WD40 repeat 317..351 CDD:293791 7/57 (12%)
WD40 repeat 356..389 CDD:293791 4/36 (11%)
WD40 repeat 396..431 CDD:293791 10/34 (29%)
WD40 repeat 437..471 CDD:293791 8/36 (22%)
WD40 repeat 477..512 CDD:293791 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.