Sequence 1: | NP_001263071.1 | Gene: | CG7568 / 43482 | FlyBaseID: | FBgn0039673 | Length: | 482 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_594559.1 | Gene: | pof11 / 2541707 | PomBaseID: | SPAC29E6.01 | Length: | 506 | Species: | Schizosaccharomyces pombe |
Alignment Length: | 219 | Identity: | 65/219 - (29%) |
---|---|---|---|
Similarity: | 113/219 - (51%) | Gaps: | 21/219 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 278 DGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWD-TRKL 341
Fly 342 DQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELE-MLSLMAGHSDEVSKVCF 405
Fly 406 SPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAILTASKDNSCRFWRXYD 470
Fly 471 W-------------YTVQLNDGSI 481 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7568 | NP_001263071.1 | WD40 | 93..466 | CDD:225201 | 60/189 (32%) |
WD40 repeat | 122..158 | CDD:293791 | |||
WD40 | 154..467 | CDD:238121 | 60/190 (32%) | ||
WD40 repeat | 189..222 | CDD:293791 | |||
WD40 repeat | 228..265 | CDD:293791 | |||
WD40 repeat | 270..306 | CDD:293791 | 8/27 (30%) | ||
WD40 repeat | 314..348 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 355..393 | CDD:293791 | 14/38 (37%) | ||
WD40 repeat | 400..436 | CDD:293791 | 12/35 (34%) | ||
WD40 repeat | 442..466 | CDD:293791 | 8/23 (35%) | ||
pof11 | NP_594559.1 | F-box-like | 77..119 | CDD:289689 | |
WD40 | <206..501 | CDD:225201 | 65/219 (30%) | ||
WD40 | 222..496 | CDD:238121 | 65/219 (30%) | ||
WD40 repeat | 224..259 | CDD:293791 | 9/28 (32%) | ||
WD40 repeat | 265..301 | CDD:293791 | 9/35 (26%) | ||
WD40 repeat | 306..344 | CDD:293791 | 14/39 (36%) | ||
WD40 repeat | 351..386 | CDD:293791 | 11/34 (32%) | ||
WD40 repeat | 392..426 | CDD:293791 | 8/35 (23%) | ||
WD40 repeat | 432..466 | CDD:293791 | 5/11 (45%) | ||
WD40 repeat | 473..495 | CDD:293791 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R947 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |