DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and pof11

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_594559.1 Gene:pof11 / 2541707 PomBaseID:SPAC29E6.01 Length:506 Species:Schizosaccharomyces pombe


Alignment Length:219 Identity:65/219 - (29%)
Similarity:113/219 - (51%) Gaps:21/219 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 DGQMLLTGSFDHSAAIWDVRSKSLGHQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWD-TRKL 341
            |.:::::||.|.:.::|||.|:.:.::|.|||..:....:....:|:.:||.|:|..||| ..:.
pombe   230 DDEIMVSGSKDRTVSVWDVNSRFILYKLYGHSGSVLCLDFCRRRNLLVSGSSDSTIIIWDWQNRR 294

  Fly   342 DQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSELE-MLSLMAGHSDEVSKVCF 405
            ..::|..  |:|.||.|.  .:...:.:.|.|.|||||||:.:|..| .:.::.||...|:.|.:
pombe   295 PLKVYFG--HTDNVLGVV--VSENYIISSSRDHTARVWRLDATSPAEACMHVLRGHLASVNSVQY 355

  Fly   406 SPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGDAILTASKDNSCRFWRXYD 470
            |....:::|||:|.|.|.|...:|.|.:::..|:..: :|| .|.|..|::.|.|.:.|.:. ..
pombe   356 SSKTGLIVTASSDRTLRTWDITTGHCIRIIHAHQRGI-ACA-QYNGKFIVSGSSDLTIRIFEASS 418

  Fly   471 W-------------YTVQLNDGSI 481
            .             .||:.||..|
pombe   419 GKLLRMLQGHEDLIRTVRFNDEKI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 60/189 (32%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 60/190 (32%)
WD40 repeat 189..222 CDD:293791
WD40 repeat 228..265 CDD:293791
WD40 repeat 270..306 CDD:293791 8/27 (30%)
WD40 repeat 314..348 CDD:293791 9/34 (26%)
WD40 repeat 355..393 CDD:293791 14/38 (37%)
WD40 repeat 400..436 CDD:293791 12/35 (34%)
WD40 repeat 442..466 CDD:293791 8/23 (35%)
pof11NP_594559.1 F-box-like 77..119 CDD:289689
WD40 <206..501 CDD:225201 65/219 (30%)
WD40 222..496 CDD:238121 65/219 (30%)
WD40 repeat 224..259 CDD:293791 9/28 (32%)
WD40 repeat 265..301 CDD:293791 9/35 (26%)
WD40 repeat 306..344 CDD:293791 14/39 (36%)
WD40 repeat 351..386 CDD:293791 11/34 (32%)
WD40 repeat 392..426 CDD:293791 8/35 (23%)
WD40 repeat 432..466 CDD:293791 5/11 (45%)
WD40 repeat 473..495 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.