DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and FBXW11

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001365903.1 Gene:FBXW11 / 23291 HGNCID:13607 Length:563 Species:Homo sapiens


Alignment Length:289 Identity:78/289 - (26%)
Similarity:126/289 - (43%) Gaps:61/289 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 SGNNLTTFSIIFSD-KIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASL 245
            |.|:...:.:.:.| ||::|..|.:.|:|..||.:.|....|||..::..::   |.:.|.|.|.
Human   258 SENSKGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQY---DERVIVTGSS 319

  Fly   246 DGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSK---SLGHQLRG 307
            |.:.|::||.|...|..|.||...|:..||:..  :::|.|.|.|.|:||:.|.   :|...|.|
Human   320 DSTVRVWDVNTGEVLNTLIHHNEAVLHLRFSNG--LMVTCSKDRSIAVWDMASATDITLRRVLVG 382

  Fly   308 HSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSS 372
            |.|.::  |.:|....|.:.|.|.|.::|.|                             :||  
Human   383 HRAAVN--VVDFDDKYIVSASGDRTIKVWST-----------------------------STC-- 414

  Fly   373 DCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAG 437
                           |.:..:.||...::  |......::::.|:|||.|||..|.|.|.:||.|
Human   415 ---------------EFVRTLNGHKRGIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEG 462

  Fly   438 HEGEVFSCAYSYAGDAILTASKDNSCRFW 466
            || |:..| ..:....|::.:.|...:.|
Human   463 HE-ELVRC-IRFDNKRIVSGAYDGKIKVW 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 77/287 (27%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 78/289 (27%)
WD40 repeat 189..222 CDD:293791 10/33 (30%)
WD40 repeat 228..265 CDD:293791 11/36 (31%)
WD40 repeat 270..306 CDD:293791 12/38 (32%)
WD40 repeat 314..348 CDD:293791 8/33 (24%)
WD40 repeat 355..393 CDD:293791 3/37 (8%)
WD40 repeat 400..436 CDD:293791 12/35 (34%)
WD40 repeat 442..466 CDD:293791 3/23 (13%)
FBXW11NP_001365903.1 Beta-TrCP_D 99..137 CDD:403372
F-box-like 141..188 CDD:403981
WD40 261..539 CDD:238121 76/286 (27%)
WD40 repeat 264..299 CDD:293791 10/34 (29%)
WD40 repeat 305..339 CDD:293791 11/36 (31%)
WD40 repeat 344..381 CDD:293791 12/38 (32%)
WD40 repeat 388..421 CDD:293791 11/80 (14%)
WD40 repeat 427..461 CDD:293791 12/35 (34%)
WD40 repeat 467..510 CDD:293791 4/24 (17%)
WD40 repeat 516..538 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.