DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and wdr-5.3

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001024299.1 Gene:wdr-5.3 / 179489 WormBaseID:WBGene00013862 Length:501 Species:Caenorhabditis elegans


Alignment Length:506 Identity:113/506 - (22%)
Similarity:184/506 - (36%) Gaps:124/506 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 EAEEEQSPADLEKSPPPRPVSGSV-ARSQNAFSALKQALEKLQKKLREPVKKKFYLHKCHNSHIL 119
            |.:|..||.::...|.|.|...|: :|...:..|:..|.:|:..          :.|  :|:...
 Worm     4 ERQETISPKNVPFQPVPTPNQQSLQSRMLESNQAVPDAFQKVAA----------WNH--YNAVAT 56

  Fly   120 PLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDN-----------------VVFSVG 167
            |...|                      .|||:.....|.|.|                 :.|...
 Worm    57 PPIGV----------------------PQTARPPSNQSPHPNPPGYPYQSHQQQFHPLAIAFQQP 99

  Fly   168 FNFPHWLVY--------------------------LQSGGSGNNLTTFSIIFSDKIVTGSFDGTA 206
            |..|..::|                          .|..||..:....|.:   .:.|.|.:||.
 Worm   100 FGLPQQVIYPPPPPGFTPHRVQVSPVGLLGPPGFFPQFAGSTTSQGNPSEV---SVRTKSAEGTT 161

  Fly   207 ----------------------KVWSATSGQSLC------------TFYGHTAELVAAEFHPVDG 237
                                  .|...||...:.            |..|||..:...:| ...|
 Worm   162 GPIAPSITTKPTSTIQVAPPRDPVAPTTSSSGITKKPENGEFSLVKTISGHTKSVSVIKF-SYCG 225

  Fly   238 KSIATASLDGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSKSLG 302
            |.:.|.|.|...::::......||.|..|...:....::.:.|.:.:.|.|.:..|:||.|.:..
 Worm   226 KYLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQFIASASDDTTVKIFDVISGACL 290

  Fly   303 HQLRGHSAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLL 367
            ..:|||:..:..|.:|...||||:...|.|.|:||. |....:.....|||.:..:|::..|..:
 Worm   291 RTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDF-KTGLCVKCIPAHSDPITSISYNHDGNTM 354

  Fly   368 ATCSSDCTARVWRLEGSSELEMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCS 432
            ||.|.|...|||.....|.|:.| :...|: .|:.|||||:|..||:|..|::.:||..:..:..
 Worm   355 ATSSYDGCIRVWDAASGSCLKTL-VDTDHA-PVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPL 417

  Fly   433 QVLAGHEGEVFSCAYSY----AGDAILTASKDNSCRFWRXYDWYTVQLNDG 479
            :...||:.:.: |.::.    .|..|::.|:|.....|. .....||:.:|
 Worm   418 KYYNGHKNKKY-CLFANMSVPLGKHIISGSEDGRILVWSIQTKQIVQILEG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 98/453 (22%)
WD40 repeat 122..158 CDD:293791 4/35 (11%)
WD40 154..467 CDD:238121 90/393 (23%)
WD40 repeat 189..222 CDD:293791 9/66 (14%)
WD40 repeat 228..265 CDD:293791 9/36 (25%)
WD40 repeat 270..306 CDD:293791 7/35 (20%)
WD40 repeat 314..348 CDD:293791 12/33 (36%)
WD40 repeat 355..393 CDD:293791 12/37 (32%)
WD40 repeat 400..436 CDD:293791 13/35 (37%)
WD40 repeat 442..466 CDD:293791 5/27 (19%)
wdr-5.3NP_001024299.1 WD40 <200..501 CDD:225201 76/273 (28%)
WD40 205..499 CDD:238121 76/268 (28%)
WD40 repeat 216..253 CDD:293791 9/37 (24%)
WD40 repeat 259..295 CDD:293791 7/35 (20%)
WD40 repeat 300..336 CDD:293791 12/36 (33%)
WD40 repeat 343..378 CDD:293791 12/35 (34%)
WD40 repeat 385..421 CDD:293791 13/35 (37%)
WD40 repeat 429..466 CDD:293791 8/36 (22%)
WD40 repeat 472..498 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.