DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and WDR88

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_775750.3 Gene:WDR88 / 126248 HGNCID:26999 Length:472 Species:Homo sapiens


Alignment Length:422 Identity:103/422 - (24%)
Similarity:170/422 - (40%) Gaps:71/422 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KSPPP-RPVS---------GSVARSQNAF------SALKQALEKLQKKLREPVKKKFYLHKCHNS 116
            |.||| .|.|         |::||:...|      :.|...|:.|... |||..     |.....
Human    17 KLPPPSAPASEYCPGKLSWGTMARALGRFKLSIPHTHLLATLDPLALD-REPPP-----HLLPEK 75

  Fly   117 HILPLTNVSFDRSGERCLTGSYDRTCHVINTQTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGG 181
            |.:|          |:.:.|..|....:       ...|||||::.|.:..|             
Human    76 HQVP----------EKLIWGDQDPLSKI-------PFKILSGHEHAVSTCHF------------- 110

  Fly   182 SGNNLTTFSIIFSDKIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPV-DGKSIATASL 245
                     .:...|:::||:|.|.|:|....| |:...:.|..:....|.... |...:..||.
Human   111 ---------CVDDTKLLSGSYDCTVKLWDPVDG-SVVRDFEHRPKAPVVECSITGDSSRVIAASY 165

  Fly   246 DGSARIYDVETSHELQQLTHHGAEVIAARFNRDGQMLLTG-SFDHSAAIWDVRSKSLGHQLRG-H 308
            |.:.|.:|:||...|.:: .:...:::.:|:.||:.:::| ..||...|.|..:.:....::. |
Human   166 DKTVRAWDLETGKLLWKV-RYDTFIVSCKFSPDGKYVVSGFDVDHGICIMDAENITTVSVIKDHH 229

  Fly   309 SAELSNCVWNFSGSLIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSD 373
            :..:::|.::.....:|:.|||...:|||.......|.:...||:.:.:..|..:|..|.|.|.|
Human   230 TRSITSCCFDPDSQRVASVSLDRCIKIWDVTSQATLLTITKAHSNAISNCCFTFSGHFLCTSSWD 294

  Fly   374 CTARVWRLEGSSELE----MLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQV 434
            ...::|.:. :.|..    .::||.||...||...|:.....|::...|.|..:|....|.....
Human   295 KNLKIWNVH-TGEFRNCGACVTLMQGHEGSVSSCHFARDSSFLISGGFDRTVAIWDVAEGYRKLS 358

  Fly   435 LAGHEGEVFSCAYSYAGDAILTASKDNSCRFW 466
            |.||...|...|.|.....||:||||.:.|.|
Human   359 LKGHNDWVMDVAISNNKKWILSASKDRTMRLW 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 91/379 (24%)
WD40 repeat 122..158 CDD:293791 5/35 (14%)
WD40 154..467 CDD:238121 81/320 (25%)
WD40 repeat 189..222 CDD:293791 9/32 (28%)
WD40 repeat 228..265 CDD:293791 10/37 (27%)
WD40 repeat 270..306 CDD:293791 8/36 (22%)
WD40 repeat 314..348 CDD:293791 9/33 (27%)
WD40 repeat 355..393 CDD:293791 8/41 (20%)
WD40 repeat 400..436 CDD:293791 8/35 (23%)
WD40 repeat 442..466 CDD:293791 10/23 (43%)
WDR88NP_775750.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 3/4 (75%)
WD40 96..391 CDD:238121 81/320 (25%)
WD40 97..>398 CDD:225201 81/319 (25%)
WD 1 100..139 13/61 (21%)
WD40 repeat 106..142 CDD:293791 10/58 (17%)
WD 2 143..182 10/38 (26%)
WD40 repeat 148..181 CDD:293791 9/32 (28%)
WD 3 184..224 8/39 (21%)
WD40 repeat 190..226 CDD:293791 8/35 (23%)
WD 4 228..267 9/38 (24%)
WD40 repeat 233..270 CDD:293791 9/36 (25%)
WD 5 271..310 10/39 (26%)
WD40 repeat 276..317 CDD:293791 8/41 (20%)
WD 6 319..358 10/38 (26%)
WD40 repeat 324..348 CDD:293791 6/23 (26%)
WD 7 361..400 13/30 (43%)
WD40 repeat 366..390 CDD:293791 10/23 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D872177at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.