DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and Btrc

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:NP_001347049.1 Gene:Btrc / 12234 MGIID:1338871 Length:619 Species:Mus musculus


Alignment Length:274 Identity:75/274 - (27%)
Similarity:118/274 - (43%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 KIVTGSFDGTAKVWSATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHEL 260
            |||:|..|.|.|:|..::.:......|||..::..::   |.:.|.|.|.|.:.|::||.....|
Mouse   329 KIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQY---DERVIITGSSDSTVRVWDVNAGEML 390

  Fly   261 QQLTHHGAEVIAARFNRDGQMLLTGSFDHSAAIWDVRSK---SLGHQLRGHSAELSNCVWNFSGS 322
            ..|.||...|:..|||..  |::|.|.|.|.|:||:.|.   :|...|.||.|.::  |.:|...
Mouse   391 NTLIHHCEAVLHLRFNNG--MMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVN--VVDFDDK 451

  Fly   323 LIATGSLDNTARIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLEGSSEL 387
            .|.:.|.|.|.::|:|                             :||                 
Mouse   452 YIVSASGDRTIKVWNT-----------------------------STC----------------- 470

  Fly   388 EMLSLMAGHSDEVSKVCFSPSGCMLLTASADNTARLWLTESGQCSQVLAGHEGEVFSCAYSYAGD 452
            |.:..:.||...::  |......::::.|:|||.|||..|.|.|.:||.||| |:..| ..:...
Mouse   471 EFVRTLNGHKRGIA--CLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHE-ELVRC-IRFDNK 531

  Fly   453 AILTASKDNSCRFW 466
            .|::.:.|...:.|
Mouse   532 RIVSGAYDGKIKVW 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 74/272 (27%)
WD40 repeat 122..158 CDD:293791
WD40 154..467 CDD:238121 75/274 (27%)
WD40 repeat 189..222 CDD:293791 8/25 (32%)
WD40 repeat 228..265 CDD:293791 10/36 (28%)
WD40 repeat 270..306 CDD:293791 14/38 (37%)
WD40 repeat 314..348 CDD:293791 8/33 (24%)
WD40 repeat 355..393 CDD:293791 3/37 (8%)
WD40 repeat 400..436 CDD:293791 12/35 (34%)
WD40 repeat 442..466 CDD:293791 3/23 (13%)
BtrcNP_001347049.1 Beta-TrCP_D 153..191 CDD:403372
F-box-like 195..242 CDD:403981
WD40 317..595 CDD:238121 75/274 (27%)
WD40 repeat 320..355 CDD:293791 8/25 (32%)
WD40 repeat 361..395 CDD:293791 10/36 (28%)
WD40 repeat 400..437 CDD:293791 14/38 (37%)
WD40 repeat 444..477 CDD:293791 11/80 (14%)
WD40 repeat 483..517 CDD:293791 12/35 (34%)
WD40 repeat 523..566 CDD:293791 4/24 (17%)
WD40 repeat 572..594 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R947
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.