DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7568 and wdr88

DIOPT Version :9

Sequence 1:NP_001263071.1 Gene:CG7568 / 43482 FlyBaseID:FBgn0039673 Length:482 Species:Drosophila melanogaster
Sequence 2:XP_004913613.1 Gene:wdr88 / 101732918 XenbaseID:XB-GENE-6044415 Length:397 Species:Xenopus tropicalis


Alignment Length:429 Identity:94/429 - (21%)
Similarity:170/429 - (39%) Gaps:101/429 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IEPLADRILLQTLAEAEEEQSPADLEKSPPPRPVSG------SVARSQ---NAFSALKQALE--- 94
            ::|||          .|:|:|.|        :|.||      |...||   ..|...|.|:.   
 Frog     3 LDPLA----------VEQERSVA--------KPQSGEESLWESERLSQVPYRVFRGHKGAVNSCH 49

  Fly    95 ------KLQKKLREPVKKKFYLHKCHNSHIL------PLTNVSFDRSGERCLTGSYDRTCHVINT 147
                  |:.....:...|.:.:.:|...|:.      |::..:.....:|.:|.|||:|..:.:.
 Frog    50 FCFEDTKILSCSHDTTAKLWDVSRCDPVHVFGDEHKAPISECNLTADNKRMVTSSYDKTVKLWDM 114

  Fly   148 QTAQVEHILSGHDNVVFSVGFNFPHWLVYLQSGGSGNNLTTFSIIFSDKIVTGSFDGTAKVW--- 209
            :..|:                   .|.|.|:...:..|:::     ..|:|..:.|....::   
 Frog   115 ECGQL-------------------IWSVSLEGLVNSCNISS-----DGKLVLCALDMDNSLYIID 155

  Fly   210 SATSGQSLCTFYGHTAELVAAEFHPVDGKSIATASLDGSARIYDVETSHELQQLTHHGAEVIA-A 273
            |||..:.......|.:.:....|.| :.:.:.:.|.|.:.:::|::..|....:.:..:.||: .
 Frog   156 SATGSKIAYIKDQHLSTITRCCFDP-EIQRVCSVSSDRTIKLWDIKAQHATIIIRNAHSNVISDC 219

  Fly   274 RFNRDGQMLLTGSFDHSAAIWDVRSKSLGHQL-----RGHSAELSNCVWNFSGSLIATGSLDNTA 333
            ||:.:|.:|.|.|:|....:||:.:....||.     :.|...:|:|.::...|:|.:|..|.|.
 Frog   220 RFSSNGHILCTASWDKCLKLWDINAGQFRHQRPDVLHKAHKGSVSSCTFSKDMSVIVSGGYDKTV 284

  Fly   334 RIWDTRKLDQELYLAARHSDEVLDVSFDAAGQLLATCSSDCTARVWRLE---------------G 383
            .:||.....::|.|.. |.|.|||||..|..:.:.:.|.|.|.|:|.:|               |
 Frog   285 VLWDVIAASKKLVLKG-HEDWVLDVSLSANKKWIVSSSKDSTLRLWNIENYEKIPAVTENIRALG 348

  Fly   384 SSELEM------LSLMAGHSDEVSKVCFSPSGCMLLTAS 416
            |:.::.      .|.|...:.::.|.|..   |.|.|.|
 Frog   349 STVVQCEECKKPFSFMNWDNPDLLKRCVF---CRLATPS 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7568NP_001263071.1 WD40 93..466 CDD:225201 78/369 (21%)
WD40 repeat 122..158 CDD:293791 7/35 (20%)
WD40 154..467 CDD:238121 66/293 (23%)
WD40 repeat 189..222 CDD:293791 6/35 (17%)
WD40 repeat 228..265 CDD:293791 6/36 (17%)
WD40 repeat 270..306 CDD:293791 13/41 (32%)
WD40 repeat 314..348 CDD:293791 9/33 (27%)
WD40 repeat 355..393 CDD:293791 15/58 (26%)
WD40 repeat 400..436 CDD:293791 6/17 (35%)
WD40 repeat 442..466 CDD:293791
wdr88XP_004913613.1 WD40 34..330 CDD:238121 69/321 (21%)
WD40 repeat 47..83 CDD:293791 4/35 (11%)
WD40 repeat 89..127 CDD:293791 10/56 (18%)
WD40 repeat 129..166 CDD:293791 7/41 (17%)
WD40 repeat 174..209 CDD:293791 6/35 (17%)
WD40 repeat 216..254 CDD:293791 12/37 (32%)
WD40 repeat 263..289 CDD:293791 8/25 (32%)
WD40 repeat 305..329 CDD:293791 10/23 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D872177at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.