DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PTC7

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_011943.2 Gene:PTC7 / 856475 SGDID:S000001118 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:339 Identity:73/339 - (21%)
Similarity:128/339 - (37%) Gaps:113/339 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GGFLDKPKTA---KHNDEGEGNKLLFGVSSMQGWRSEMEDAYYAR--------AGLGDALPDWSF 55
            |.|..|...|   |..|:....||...:.|..|     ||.|:..        ||:.|.:..|:.
Yeast    57 GPFTYKTAVAFQPKDRDDLIYQKLKDSIRSPTG-----EDNYFVTSNNVHDIFAGVADGVGGWAE 116

  Fly    56 FAVFDGHA----GCK--------VSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMREL 108
            .. :|..|    .||        ::|:.:|   |::::.::.||..:.|      :|.::|:   
Yeast   117 HG-YDSSAISRELCKKMDEISTALAENSSK---ETLLTPKKIIGAAYAK------IRDEKVV--- 168

  Fly   109 PEFTRESEKCGGTTAVCA-FVGLTQVYIANCGDSRAVLCRQGVPVFATQDHK---------PILP 163
                    |.|||||:.| |....::.:||.|||...:.|....||.|:...         .|:|
Yeast   169 --------KVGGTTAIVAHFPSNGKLEVANLGDSWCGVFRDSKLVFQTKFQTVGFNAPYQLSIIP 225

  Fly   164 EEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLV 228
            ||..:.....||..|      |...|...:|.|: :|:|                      :.::
Yeast   226 EEMLKEAERRGSKYI------LNTPRDADEYSFQ-LKKK----------------------DIII 261

  Fly   229 LACDGIWDVMSNEDVCSFIHSR------------MRVTSNLVSIAN---------QVVDTCLHK- 271
            ||.||:.|.::.:|:..|:...            .:...|:||::.         |.:.....| 
Yeast   262 LATDGVTDNIATDDIELFLKDNAARTNDELQLLSQKFVDNVVSLSKDPNYPSVFAQEISKLTGKN 326

  Fly   272 ---GSRDNMSIIII 282
               |..|:::::::
Yeast   327 YSGGKEDDITVVVV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 65/314 (21%)
PP2C_C 278..352 CDD:285117 0/5 (0%)
PTC7NP_011943.2 PTC1 50..343 CDD:223704 73/339 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.