DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PPM1D

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_003611.1 Gene:PPM1D / 8493 HGNCID:9277 Length:605 Species:Homo sapiens


Alignment Length:303 Identity:92/303 - (30%)
Similarity:130/303 - (42%) Gaps:74/303 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DALPD----------------WSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVK---G 93
            |.|||                .:||||.|||.|.:.::...:||...|...:.|...:..|   .
Human    77 DPLPDAGASPAPSRCCRRRSSVAFFAVCDGHGGREAAQFAREHLWGFIKKQKGFTSSEPAKVCAA 141

  Fly    94 IRTGFLRIDEVM----RELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVP--- 151
            ||.|||.....|    .|.|:.........||||....:...::|:|:.|||..||..|..|   
Human   142 IRKGFLACHLAMWKKLAEWPKTMTGLPSTSGTTASVVIIRGMKMYVAHVGDSGVVLGIQDDPKDD 206

  Fly   152 ----VFATQDHKPILPEEKERIYNAGGSVM----IKRV---------NGT------------LAV 187
                |..||||||.||:|:|||...|||||    :.||         ||.            |||
Human   207 FVRAVEVTQDHKPELPKERERIEGLGGSVMNKSGVNRVVWKRPRLTHNGPVRRSTVIDQIPFLAV 271

  Fly   188 SRALGD---YDFKNVKEKGQCEQLVSPEPEIFCQSRQ-DSDEFLVLACDGIWDVMSNEDVCSFI- 247
            :|||||   |||.:      .|.:|||||:....:.. ...::::|..||:|:::..:|..|.. 
Human   272 ARALGDLWSYDFFS------GEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPPQDAISMCQ 330

  Fly   248 ---HSRMRVTSNLVSIANQVVDTCLHKGSR-----DNMSIIII 282
               ..:..:..:..|.|..:|:..|.:..:     ||.|.|:|
Human   331 DQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 92/303 (30%)
PP2C_C 278..352 CDD:285117 3/5 (60%)
PPM1DNP_003611.1 Interaction with CHEK1. /evidence=ECO:0000269|PubMed:15870257 1..101 4/23 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..90 4/12 (33%)
PP2C 67..368 CDD:278884 88/296 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 516..591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.