DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and AT1G17545

DIOPT Version :10

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_173198.1 Gene:AT1G17545 / 838329 AraportID:AT1G17545 Length:179 Species:Arabidopsis thaliana


Alignment Length:104 Identity:25/104 - (24%)
Similarity:42/104 - (40%) Gaps:33/104 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCG 119
            ||.::|||       ..::.:..|:.|.:..:                 :....||..       
plant   105 FFGIYDGH-------RRSRPVSGSVSSDDRMV-----------------LQAVSPETV------- 138

  Fly   120 GTTAVCAFVGLTQVYIANCGDSRAVLCR--QGVPVFATQ 156
            |:|||.|.|..:.:.::|||.||.||.|  :.:|:...|
plant   139 GSTAVVALVCSSHIIVSNCGGSRVVLLRGKESMPLSVDQ 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 25/104 (24%)
PP2C_C 278..355 CDD:429684
AT1G17545NP_173198.1 PP2Cc 80..>179 CDD:469621 25/104 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.