DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and HAI2

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_172223.1 Gene:HAI2 / 837255 AraportID:AT1G07430 Length:442 Species:Arabidopsis thaliana


Alignment Length:343 Identity:113/343 - (32%)
Similarity:160/343 - (46%) Gaps:65/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAY-----YARAGLGDALPDWSFFAVFDGHAGCKVS 68
            ||.|..|    .:..:||:|:.|.|.:||||.     :.|.....:...|.:|.|:|||....|:
plant   110 KTVKETD----LRPRYGVASVCGRRRDMEDAVALHPSFVRKQTEFSRTRWHYFGVYDGHGCSHVA 170

  Fly    69 EHCAKHLLESIISTEEFIGG---DHVKGIRTGFLRID-EVMR------------ELPEFTRESEK 117
            ..|.:.|.|.:  .||.:..   :..|.:...|.|:| ||:|            ||     ::..
plant   171 ARCKERLHELV--QEEALSDKKEEWKKMMERSFTRMDKEVVRWGETVMSANCRCEL-----QTPD 228

  Fly   118 CG--GTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMI-- 178
            |.  |:|||.:.:...::.:||||||||||||.|..|..:.||||..|:|.:||..|||.|:.  
plant   229 CDAVGSTAVVSVITPEKIIVANCGDSRAVLCRNGKAVPLSTDHKPDRPDELDRIQEAGGRVIYWD 293

  Fly   179 -KRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNED 242
             .||.|.||:|||:||...|         ..|:.|||:....|.:.||||:||.||:|||::||.
plant   294 GARVLGVLAMSRAIGDNYLK---------PYVTSEPEVTVTDRTEEDEFLILATDGLWDVVTNEA 349

  Fly   243 VCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEK 307
            .|:.:  ||                ||::.|...........||. :..||..|.|.::....:.
plant   350 ACTMV--RM----------------CLNRKSGRGRRRGETQTPGR-RSEEEGKEEEEKVVGSRKN 395

  Fly   308 ITRDEIESSKITDYVDLL 325
            ..|.||.....|:...||
plant   396 GKRGEITDKACTEASVLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 97/285 (34%)
PP2C_C 278..352 CDD:285117 12/48 (25%)
HAI2NP_172223.1 PP2Cc 116..431 CDD:214625 110/337 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.