DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PP2CG1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_180926.1 Gene:PP2CG1 / 817935 AraportID:AT2G33700 Length:380 Species:Arabidopsis thaliana


Alignment Length:326 Identity:102/326 - (31%)
Similarity:166/326 - (50%) Gaps:43/326 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVSSMQGWRSEMEDAYYARAG----LGDALPDWS---FFAVFDGHAGCKVSEHCAKHLLESIIST 82
            |..:.||.:..|||.:.....    ||.|:...|   |:.|||||.|...:....|::|..|:..
plant    86 GSCAEQGAKQFMEDEHICIDDLVNHLGAAIQCSSLGAFYGVFDGHGGTDAAHFVRKNILRFIVED 150

  Fly    83 EEF---IGGDHVKGIRTGFLRIDEVMRELPEFTRES--EKCGGTTAVCAFVGLTQVYIANCGDSR 142
            ..|   :    .|.|::.||:.|.      ||..:|  :...||||:.||:...::.|||.||.|
plant   151 SSFPLCV----KKAIKSAFLKADY------EFADDSSLDISSGTTALTAFIFGRRLIIANAGDCR 205

  Fly   143 AVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQ 207
            |||.|:|..:..::||||....||.||...||.|....:||.|:|:||:||:..|..|... |. 
plant   206 AVLGRRGRAIELSKDHKPNCTAEKVRIEKLGGVVYDGYLNGQLSVARAIGDWHMKGPKGSA-CP- 268

  Fly   208 LVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKG 272
             :|||||:......:.||||::.|||:|||||::...:.....:.:.::....:.::|...|.:.
plant   269 -LSPEPELQETDLSEDDEFLIMGCDGLWDVMSSQCAVTIARKELMIHNDPERCSRELVREALKRN 332

  Fly   273 SRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQNRDDIEGL 337
            :.||:::|::.|  :|.|.:       |:|.:::...|..|.:    :.::|||.:     ::|.
plant   333 TCDNLTVIVVCF--SPDPPQ-------RIEIRMQSRVRRSISA----EGLNLLKGV-----LDGY 379

  Fly   338 P 338
            |
plant   380 P 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 90/270 (33%)
PP2C_C 278..352 CDD:285117 13/61 (21%)
PP2CG1NP_180926.1 PP2C_C 74..378 CDD:421906 100/322 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1481
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.