DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and DBP1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001324148.1 Gene:DBP1 / 817102 AraportID:AT2G25620 Length:392 Species:Arabidopsis thaliana


Alignment Length:323 Identity:101/323 - (31%)
Similarity:163/323 - (50%) Gaps:29/323 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EGNKLLF------GVSSMQGWRSEMEDAYYA------RAGL--GDALPDWSFFAVFDGHAGCKVS 68
            |.||..|      |..|..|.||.|||||..      ..||  .:|.|. :|:.|||||.|...:
plant    78 EKNKSEFVPATRSGAWSDIGSRSSMEDAYLCVDNFMDSFGLLNSEAGPS-AFYGVFDGHGGKHAA 141

  Fly    69 EHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQV 133
            |....|:...|:..:|| ..:..|.:.:.||:.|...  |...:.:.....||||:.|.:....:
plant   142 EFACHHIPRYIVEDQEF-PSEINKVLSSAFLQTDTAF--LEACSLDGSLASGTTALAAILFGRSL 203

  Fly   134 YIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKN 198
            .:||.||.||||.|||..:..::||||:..:|:.||..:||.|....:||.|.|:|||||:..:.
plant   204 VVANAGDCRAVLSRQGKAIEMSRDHKPMSSKERRRIEASGGHVFDGYLNGQLNVARALGDFHMEG 268

  Fly   199 VKEK---GQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSI 260
            :|:|   ..|..|:: |||:......:.||||::.|||:|||..:::...|...|::..::.|..
plant   269 MKKKKDGSDCGPLIA-EPELMTTKLTEEDEFLIIGCDGVWDVFMSQNAVDFARRRLQEHNDPVMC 332

  Fly   261 ANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVD 323
            :.::|:..|.:.|.||::.:::..  .|:|....:....|:.:........:::|     |:|
plant   333 SKELVEEALKRKSADNVTAVVVCL--QPQPPPNLVAPRLRVHRSFSAEGLKDLQS-----YLD 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 92/276 (33%)
PP2C_C 278..352 CDD:285117 6/46 (13%)
DBP1NP_001324148.1 PLN03145 3..392 CDD:215603 101/323 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 144 1.000 Domainoid score I1481
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.