DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and AT2G25070

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001324497.1 Gene:AT2G25070 / 817045 AraportID:AT2G25070 Length:355 Species:Arabidopsis thaliana


Alignment Length:367 Identity:133/367 - (36%)
Similarity:193/367 - (52%) Gaps:64/367 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGC 65
            ||.:|..|||.|.:::||.:||.||:|||||||:.||||:.|...|.|..   |||.|:|||.|.
plant     1 MGTYLSSPKTEKLSEDGENDKLRFGLSSMQGWRATMEDAHAAILDLDDKT---SFFGVYDGHGGK 62

  Fly    66 KVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVM------REL---------------- 108
            .|::.|||:|.:.:||.|.:..||....:|..|.|:|::|      |||                
plant    63 VVAKFCAKYLHQQVISNEAYKTGDVETSLRRAFFRMDDMMQGQRGWRELAVLGDKMNKFSGMIEG 127

  Fly   109 ------------------------PEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG 149
                                    .:||..:..|   ||..|.:...::::||.||||.|:.|:.
plant   128 FIWSPRSGDTNNQPDSWPLEDGPHSDFTGPTSGC---TACVALIKDKKLFVANAGDSRCVISRKS 189

  Fly   150 VPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPE 214
            .....::||||.|..|||||..|||.:...|:||:|.::||:||.:||..|.....:|:|:.:|:
plant   190 QAYNLSKDHKPDLEVEKERILKAGGFIHAGRINGSLNLTRAIGDMEFKQNKFLPSEKQMVTADPD 254

  Fly   215 IFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSR----- 274
            |......|.|:|||:|||||||.||::::..|||.:::..:.|.::..:|||.||...:.     
plant   255 INTIDLCDDDDFLVVACDGIWDCMSSQELVDFIHEQLKSETKLSTVCEKVVDRCLAPDTATGEGC 319

  Fly   275 DNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESS 316
            |||:||::.|   .||.....|.|....:..|    ||..||
plant   320 DNMTIILVQF---KKPNPSETEPEDSKPEPSE----DEPSSS 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 112/310 (36%)
PP2C_C 278..352 CDD:285117 12/39 (31%)
AT2G25070NP_001324497.1 PP2Cc 14..327 CDD:214625 116/318 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 1 1.010 - - D957254at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.