DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ilkap

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_075832.1 Gene:Ilkap / 67444 MGIID:1914694 Length:392 Species:Mus musculus


Alignment Length:365 Identity:104/365 - (28%)
Similarity:164/365 - (44%) Gaps:103/365 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GG---FLDKPKTAKHND-------------EGEGNK------------------------LLFG- 25
            ||   |.|.|..|..|.             ||:|.|                        ::|| 
Mouse    43 GGPLLFDDLPPAASGNSGSLATSGSQVVKTEGKGAKRKAPEEEKNGGEELVEKKVCKASSVIFGL 107

  Fly    26 ---VSSMQGWRSEMEDAYYARAGLGDALPDW----------SFFAVFDGHAGCKVSEHCAKHLLE 77
               |:..:|.|.||:||:..   |.|...:.          |:|||||||.|.:.|:..|::|.:
Mouse   108 KGYVAERKGEREEMQDAHVI---LNDITQECNPPSSLITRVSYFAVFDGHGGIRASKFAAQNLHQ 169

  Fly    78 SIISTEEFIGGDHVKGIRT-------GFLRIDEVMRELPEFTRE--SEKCG---GTTAVCAFVGL 130
            ::|  .:|..||.:...:|       .|...||      ||.::  |:|..   |:||.|.....
Mouse   170 NLI--RKFPKGDIISVEKTVKRCLLDTFKHTDE------EFLKQASSQKPAWKDGSTATCVLAVD 226

  Fly   131 TQVYIANCGDSRAVLCR------QGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSR 189
            ..:||||.|||||:|||      :...:..:::|.|...||:.||..|||:|...||.|.|.|||
Mouse   227 NILYIANLGDSRAILCRYNEESQKHAALSLSKEHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSR 291

  Fly   190 ALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHS----- 249
            ::||..:|      :|.  |:..|:|.......:|.|::|||||::.|.:.|:..:||.|     
Mouse   292 SIGDGQYK------RCG--VTSVPDIRRCQLTPNDRFILLACDGLFKVFTPEEAVNFILSCLEDD 348

  Fly   250 -------RMRVTSNLVSIANQVVDTCLHKGSRDNMSIIII 282
                   :..|.:...:..|::.:..:.:||.||::::::
Mouse   349 KIQTREGKPAVDARYEAACNRLANKAVQRGSADNVTVMVV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 93/303 (31%)
PP2C_C 278..352 CDD:285117 0/5 (0%)
IlkapNP_075832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..91 11/47 (23%)
PP2Cc 108..390 CDD:238083 91/300 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.