DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and ilkap

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_012825945.1 Gene:ilkap / 595059 XenbaseID:XB-GENE-1000324 Length:364 Species:Xenopus tropicalis


Alignment Length:291 Identity:91/291 - (31%)
Similarity:145/291 - (49%) Gaps:48/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSSMQGWRSEMEDAYYARAGLGDALP------DWSFFAVFDGHAGCKVSEHCAKHLLESIISTEE 84
            |:..:|.|.|::||:.......|..|      ..|:|||||||.|.:.|...|::|.::.:....
 Frog    84 VAERRGEREELQDAHTICDLSQDCQPMPPDLLRLSYFAVFDGHGGTRASRFAAQNLHQNFVKKIP 148

  Fly    85 FIGGDHV-----KGIRTGFLRIDEVMRELPEFTRE--SEKCG---GTTAVCAFVGLTQVYIANCG 139
            ...|..|     :.|...|.:.||      :|.::  |:|..   ||||:|..|....:||||.|
 Frog   149 RGEGSSVDKAMKRCILDAFKQTDE------DFLKQAASQKPAWKDGTTAICVLVADNILYIANLG 207

  Fly   140 DSRAVLCR------QGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALGDYDFKN 198
            ||||:|||      :.|.:..:::|.|...||:.||..|||:|...||.|.|.|||::||..:|.
 Frog   208 DSRALLCRINKENQKHVVLSLSREHNPTQYEERMRIQKAGGNVRDGRVLGVLEVSRSIGDGQYKR 272

  Fly   199 VKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFI--HSRMRVT------- 254
            ..        |...||:......|||.|::|||||::...|.|:..:||  |::.:.:       
 Frog   273 YG--------VISTPEVKRCPLTDSDRFILLACDGLFKAFSAEEAVTFILTHTQEKSSPAEDGPP 329

  Fly   255 ---SNLVSIANQVVDTCLHKGSRDNMSIIII 282
               |...|..:::.:..:.:|:.||::::|:
 Frog   330 DFDSLYESACHRLANEAVRRGAADNVTVLIV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 91/291 (31%)
PP2C_C 278..352 CDD:285117 1/5 (20%)
ilkapXP_012825945.1 PP2Cc 81..362 CDD:238083 91/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.