Sequence 1: | NP_651701.1 | Gene: | alph / 43481 | FlyBaseID: | FBgn0086361 | Length: | 374 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571700.1 | Gene: | pdp2 / 58149 | ZFINID: | ZDB-GENE-000921-2 | Length: | 530 | Species: | Danio rerio |
Alignment Length: | 391 | Identity: | 90/391 - (23%) |
---|---|---|---|
Similarity: | 137/391 - (35%) | Gaps: | 128/391 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 56 FAVFDGHAG--C--KVSEHCAKHL------------LESIIST---------------------- 82
Fly 83 ------------EEFIGG-DHVKGIRT------GFLRID---------EVMRELPEFTRESEKCG 119
Fly 120 GTTAVCAFVGLTQVYIANCGDSRAVLCRQ-------GVPVFATQDHKPILPEEKERIYNAGGS-- 175
Fly 176 ----VMIKRVNGTLAVSRALGDYDFK-------NVKEKGQCE-------QLVSPE---------- 212
Fly 213 PEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSF-------IHSRMRVTSNLVSIANQVVDTCLH 270
Fly 271 KGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVDLLKCLQN--RDD 333
Fly 334 I 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
alph | NP_651701.1 | PP2Cc | 24..284 | CDD:238083 | 80/337 (24%) |
PP2C_C | 278..352 | CDD:285117 | 10/59 (17%) | ||
pdp2 | NP_571700.1 | PP2Cc | 109..517 | CDD:238083 | 90/391 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170577940 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |