Sequence 1: | NP_651701.1 | Gene: | alph / 43481 | FlyBaseID: | FBgn0086361 | Length: | 374 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009303413.1 | Gene: | pptc7b / 562909 | ZFINID: | ZDB-GENE-081105-111 | Length: | 297 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 34/199 - (17%) |
---|---|---|---|
Similarity: | 70/199 - (35%) | Gaps: | 49/199 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 GLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELP 109
Fly 110 EFTRESEKCGGTTAVCAFV---GLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYN 171
Fly 172 AGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSD--EFLVLACDGI 234
Fly 235 WDVM 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
alph | NP_651701.1 | PP2Cc | 24..284 | CDD:238083 | 34/199 (17%) |
PP2C_C | 278..352 | CDD:285117 | |||
pptc7b | XP_009303413.1 | PP2Cc | 53..289 | CDD:294085 | 34/199 (17%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0631 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |