DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and pptc7b

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_009303413.1 Gene:pptc7b / 562909 ZFINID:ZDB-GENE-081105-111 Length:297 Species:Danio rerio


Alignment Length:199 Identity:34/199 - (17%)
Similarity:70/199 - (35%) Gaps:49/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELP 109
            |:.|.:..|..:.|........:.:.|     |.::....|.....|..:.:|:..:  :..::|
Zfish    68 GVADGVGGWRDYGVDPSQFSATLMKTC-----ERLVKEGRFTPSSPVGILTSGYYEL--LQNKVP 125

  Fly   110 EFTRESEKCGGTTAVCAFV---GLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYN 171
            ..        |::..|..|   ...:::..|.|||..::.|.|..|     |:   .:|::..:|
Zfish   126 LL--------GSSTACIVVLDRRSHRIHTCNLGDSGFLVVRGGEVV-----HR---SDEQQHYFN 174

  Fly   172 AGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSD--EFLVLACDGI 234
            ....:                     ::...|....::|..||....|..|..  :.::.|.||:
Zfish   175 TPFQL---------------------SIAPPGAEGVVLSDSPEAADSSSFDVQLGDIILTATDGL 218

  Fly   235 WDVM 238
            :|.|
Zfish   219 FDNM 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 34/199 (17%)
PP2C_C 278..352 CDD:285117
pptc7bXP_009303413.1 PP2Cc 53..289 CDD:294085 34/199 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.