DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and ppm1ka

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_009295416.1 Gene:ppm1ka / 562087 ZFINID:ZDB-GENE-110411-37 Length:370 Species:Danio rerio


Alignment Length:295 Identity:95/295 - (32%)
Similarity:150/295 - (50%) Gaps:29/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGD 89
            |.:::.|.|.|.||    |..:.:...:..:||:||||.|...:::|.||:.::|....| :..|
Zfish    94 GCATLIGRRRENED----RFQVSELTQNVLYFALFDGHGGAHAADYCHKHMEQNIRDCLE-METD 153

  Fly    90 HVKGIRTGFLRIDEVMRE-LPEFTRESEKCGGTTAVCAFV--GLTQVYIANCGDSRAVLCRQGVP 151
            ....:...||.:|..:.| |..:...|....||||..|.:  |: ::.:.:.|||||:|||:|..
Zfish   154 LQTVLSKAFLEVDAALEEKLQIYGNASLMMVGTTATVALLRDGI-ELVVGSVGDSRALLCRKGKS 217

  Fly   152 VFATQDHKPILPEEKERIYNAGG-----SVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSP 211
            ...|.||.|...:||.||..:||     ||....|||.||::|::||:|   :|:.|     |..
Zfish   218 RKLTDDHTPERKDEKHRIRQSGGFVTWNSVGQANVNGRLAMTRSIGDFD---LKKSG-----VIA 274

  Fly   212 EPEIFCQSRQDS-DEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLHKGSRD 275
            ||||.....|.: |.||||..||:..:|||:::|..|:    :..:....||.:.:..|..||.|
Zfish   275 EPEITRTLLQHAHDSFLVLTTDGVNFIMSNQEICDIIN----LCHDPTEAANVIAEQALQYGSED 335

  Fly   276 NMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITR 310
            |.::|::.|....|  .:..:..|.:.:....|.|
Zfish   336 NSTVIVVPFGAWGK--HQNTDYTHDMSRNFASIGR 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 90/267 (34%)
PP2C_C 278..352 CDD:285117 6/33 (18%)
ppm1kaXP_009295416.1 PP2Cc 92..344 CDD:238083 90/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.