DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and ppm1kb

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001314673.1 Gene:ppm1kb / 503713 ZFINID:ZDB-GENE-050306-8 Length:372 Species:Danio rerio


Alignment Length:289 Identity:91/289 - (31%)
Similarity:145/289 - (50%) Gaps:49/289 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHL---LESIISTE--- 83
            |.:|..|.|.|.||.|.    :.....:..:|||||||.|.:.::.|.|::   ::.|.:.|   
Zfish    96 GSASQIGQRKENEDRYQ----MSQMTDNIMYFAVFDGHGGAEAADFCHKNMEKHIKDIAAEETNL 156

  Fly    84 EFIGGDHVKGIRTGFLRIDEVMRELPEFTRE-SEKCGGTTAVCAFV--GLTQVYIANCGDSRAVL 145
            ||:       :...||.:|:.:.....|:.: |....||||..|.:  |: ::.:.:.|||||::
Zfish   157 EFV-------LTKAFLEVDKALARHLHFSADASVLSAGTTATVALLRDGI-ELVVGSVGDSRAMM 213

  Fly   146 CRQGVPVFATQDHKPILPEEKERIYNAGG-----SVMIKRVNGTLAVSRALGDYDFKNVKEKGQC 205
            ||:|..|..|.||.|...:|||||..:||     |:....|||.||::|::||:|.|...     
Zfish   214 CRKGKAVKLTVDHTPERKDEKERIRRSGGFITWNSLGQPHVNGRLAMTRSIGDFDLKATG----- 273

  Fly   206 EQLVSPEPEIFCQSRQDS-----DEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVV 265
               |..|||    :::.|     |.||.|..|||..:|:::::|..|:.    ..:....|.::.
Zfish   274 ---VIAEPE----TKRISLHHVHDSFLALTTDGINFIMNSQEICDVINQ----CHDPKEAAQRIS 327

  Fly   266 DTCLHKGSRDNMSIIIIAFP--GAPKPTE 292
            :..|..||.||.:||::.|.  |..|.:|
Zfish   328 EQALQYGSEDNSTIIVVPFGAWGKHKSSE 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 87/277 (31%)
PP2C_C 278..352 CDD:285117 6/17 (35%)
ppm1kbNP_001314673.1 PP2Cc 94..346 CDD:238083 87/277 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.