DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and fig

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651724.1 Gene:fig / 43511 FlyBaseID:FBgn0039694 Length:314 Species:Drosophila melanogaster


Alignment Length:336 Identity:64/336 - (19%)
Similarity:111/336 - (33%) Gaps:107/336 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GGFLDKPKTAKHND--------EGEGNKLLFGVSSMQGWRSEM---EDAYYARA-------GLGD 48
            |.|...|::.|.:.        :|...|..|     .|.||..   ||:::..:       |:.|
  Fly    28 GRFERPPQSGKSSRDPYLVTVVQGRSKKPRF-----PGERSNQRFGEDSWFVSSTPLAEVMGVAD 87

  Fly    49 ALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTR 113
            .:..|....|..|....::...|:..     ....:|.|......:..||..:..         |
  Fly    88 GVGGWRDLGVDAGRFAKELMSCCSGQ-----TQLSDFDGRSPRNMLIAGFQELSH---------R 138

  Fly   114 ESEKCGGTTAVCAFVGLTQ--VYIANCGDSRAVLCRQGVPV---------FATQDHKPILPEEKE 167
            |....|.:||..|.:....  :|.||.|||..::.|.|..:         |.|.....:.||:: 
  Fly   139 EHPVVGSSTACLATMHRKDCTLYTANLGDSGFLVVRNGRVLHRSVEQTHDFNTPYQLTVPPEDR- 202

  Fly   168 RIYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQD--SDEFLVLA 230
                                            ||...|:     :||:...:|..  ..:.::||
  Fly   203 --------------------------------KESYYCD-----KPEMAVSTRHSLLPGDLVLLA 230

  Fly   231 CDGIWDVMSNEDVCSFIHS-RMRVTSNLVSIANQVVDTCLH-------------KGSRDNMSIII 281
            .||::|.|....:.|.::. :.|...:|:..|::||:....             |..:.|:|   
  Fly   231 TDGLFDNMPESMLLSILNGLKERGEHDLLVGASRVVEKARELSMNASFQSPFAIKARQHNVS--- 292

  Fly   282 IAFPGAPKPTE 292
              :.|..||.:
  Fly   293 --YSGGGKPDD 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 55/296 (19%)
PP2C_C 278..352 CDD:285117 4/15 (27%)
figNP_651724.1 PP2Cc 68..306 CDD:294085 54/291 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.