DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ppm1e

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_942068.1 Gene:Ppm1e / 360593 RGDID:735028 Length:750 Species:Rattus norvegicus


Alignment Length:404 Identity:99/404 - (24%)
Similarity:180/404 - (44%) Gaps:87/404 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSSMQGWRSEMEDAYYARAGLGDALPDW------------SFFAVFDGHAGCKVSEHCAKHLLES 78
            :.:::..|.:|||.:.       .:||:            ::|||||||.|...:.:.:.||..:
  Rat   231 IHAIKNMRRKMEDKHV-------CIPDFNMLFNLEDQEEQAYFAVFDGHGGVDAAIYASVHLHVN 288

  Fly    79 IISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRA 143
            ::..|.| ..|..:.:...|...||  |.:.:..|||.:| |||.|..|:....:::|..|||:.
  Rat   289 LVRQEMF-PHDPAEALCRAFRVTDE--RFVQKAARESLRC-GTTGVVTFIRGNMLHVAWVGDSQV 349

  Fly   144 VLCRQGVPVFATQDHKPILPEEKERIYNAGGSVM---IKRVNGTLAVSRALGDYDFKNVKEKGQC 205
            :|.|:|..|...:.|||...:||:||...||.|:   ..||||:|:||||:||.:.|        
  Rat   350 MLVRKGQAVELMKPHKPDREDEKQRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHK-------- 406

  Fly   206 EQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVS-IANQVVDTCL 269
             ..:..:.:........::::|:|||||.:|.::.::....:...::..:...| :|:::|.:..
  Rat   407 -PYICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVVSDHLKENNGDSSMVAHKLVASAR 470

  Fly   270 HKGSRDNMSIIII--------------------AFPGA----------------PKPTEE-AIEA 297
            ..||.||:::|::                    :|.|.                |.|..: :..|
  Rat   471 DAGSSDNITVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPA 535

  Fly   298 EHRLEKQIEKIT-------RDEIESSKITDYVDLLKCLQNR-DDIEGLPP----GGGLQSKYHVI 350
            :...|.:::..|       ..:|...:..||:||.:...:: ...:.|||    |.|...|.:|.
  Rat   536 DLGYEGRVDSFTDRTSLSPGPQINVLEDPDYLDLTQIETSKPHSTQFLPPVEMIGPGAPKKAYVN 600

  Fly   351 ERTFKQE--FPDRP 362
            |...::.  .|.:|
  Rat   601 ELIMEESSVTPSQP 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 77/293 (26%)
PP2C_C 278..352 CDD:285117 20/122 (16%)
Ppm1eNP_942068.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..128
7 X 2 AA tandem repeats of P-E 31..44
PP2Cc 227..485 CDD:238083 77/273 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 495..535 4/39 (10%)
M-inducer_phosp <505..>554 CDD:284119 7/48 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.