DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Pp2d1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_038939402.1 Gene:Pp2d1 / 316157 RGDID:1564811 Length:651 Species:Rattus norvegicus


Alignment Length:397 Identity:80/397 - (20%)
Similarity:150/397 - (37%) Gaps:124/397 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LLFGV----SSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAK-------HL 75
            |:.|:    :|...|::|....:......||. .:..||.:||.|.|...::..:|       |.
  Rat   197 LIKGIAICSNSNSTWKAEPNCKFTVVNDFGDK-ANVCFFGLFDSHHGYAAADLASKEFQVLLLHQ 260

  Fly    76 L-------ESIISTEEFIGGDHV-----------------KGIRT--------------GFLRID 102
            |       :.....::.|...|.                 |..||              .|.|:|
  Rat   261 LSVQDPSYQMTAEQQDLINSFHTVFREEYRAREEAFSSTYKTFRTNKREYEDVHKAFAKAFWRMD 325

  Fly   103 EVMR-------------------------ELPEFTRESEKC--GGTTAVCAFVGLTQV-----YI 135
            .::|                         :.|:.|::.||.  .|..: ..|..:.|:     :|
  Rat   326 RLLRLGRNEVSRVRWSGCSALTCILEGGIKNPQATKDWEKTYQHGVNS-SPFQKIPQIISGVLHI 389

  Fly   136 ANCGDSRAVLCRQGVPVFATQDHKPILPEEKERI-YNAGGSVMIKR------VNGTLAVSRALGD 193
            ||.|:.:|||||.|.....|::|.....:|:.|: |:..|   |..      ::|.:..:|.||.
  Rat   390 ANAGNVQAVLCRNGKGFCLTKEHTTRNTKERRRVLYSEVG---ISSDDPYGLLDGHIKTTRGLGF 451

  Fly   194 YDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLV 258
            :.  |::.|    :.:.|.|:.......|..:||:||.:|:|.|:..::          ||:.::
  Rat   452 HG--NLRLK----KAIIPVPQTISVPIDDLCQFLILATNGLWQVLDKKE----------VTALVI 500

  Fly   259 SIANQVVDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKITDYVD 323
            ::.:...:||: .|.|:.           |.|::..:...   :..|..:.:.:.|:..||...|
  Rat   501 TLFHAYKETCV-SGPRNK-----------PWPSKSLLFPP---DSNIRVLFQYQPENEDITSTTD 550

  Fly   324 LLKCLQN 330
            ::|.|.:
  Rat   551 VMKRLSD 557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 70/347 (20%)
PP2C_C 278..352 CDD:285117 9/53 (17%)
Pp2d1XP_038939402.1 PP2Cc 214..499 CDD:238083 63/305 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.