DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Tab1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001103446.1 Gene:Tab1 / 315139 RGDID:1306216 Length:502 Species:Rattus norvegicus


Alignment Length:321 Identity:77/321 - (23%)
Similarity:132/321 - (41%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 FAVFDGHAGCKVSEHCAKHLLESIISTEEFIG---GDHVKG------------IRTGFLR-IDEV 104
            :.||:|:.|.:|:...|:.|     |.|..:|   .:|...            :...||. ||:.
  Rat    65 YGVFNGYDGNRVTNFVAQRL-----SAELLLGQLNTEHTDADVRRVLLQAFDVVERSFLESIDDA 124

  Fly   105 MRE-----------------LPEFTR--------ESEKCGGTTAVCAFVGLTQVYIANCGDSRAV 144
            :.|                 ||::.:        |.|..||..||.|.:...::|:||.|.:||:
  Rat   125 LAEKASLQSQLPEGVPQHQLLPQYQKILERLKALEKEISGGAMAVVAVLLNNKLYVANVGTNRAL 189

  Fly   145 LCRQGVP-VFATQ---DHKPILPEEKERIYNAG-GSVMIKRVNGTLA---VSRALGDYDFK---- 197
            |||..|. :..||   ||.....:|..|:...| .:..||:| |.:.   .:|.:|||..|    
  Rat   190 LCRSTVDGLQVTQLNVDHTAENEDELFRLSQLGLDAGKIKQV-GVICGQESTRRIGDYKVKYGYT 253

  Fly   198 --NVKEKGQCEQLVSPEPEIF-CQSRQDSDEFLVLACDGIWDVM--------SNEDVCSFIHSRM 251
              ::....:.:.::: ||||. .|.......||||..:|::..:        :|::|.:.|.:..
  Rat   254 DIDLLSTAKSKPIIA-EPEIHGAQPLDGVTGFLVLMSEGLYKALEAAHGPGQANQEVAAMIDTEF 317

  Fly   252 RVTSNLVSIANQVV--------DTCLHKGSR-------DNMSIII--IAFP----GAPKPT 291
            ...::|.::|..||        ||....|.|       ::|::::  ..:|    ..|.||
  Rat   318 AKQTSLDAVAQAVVDRVKRIHSDTFASGGERAKFCPRHEDMTLLVRNFGYPLGEMSQPTPT 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 73/308 (24%)
PP2C_C 278..352 CDD:285117 4/20 (20%)
Tab1NP_001103446.1 PP2C 69..334 CDD:278884 66/271 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.