DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ppm1h

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001258008.1 Gene:Ppm1h / 314897 RGDID:1309528 Length:513 Species:Rattus norvegicus


Alignment Length:410 Identity:87/410 - (21%)
Similarity:134/410 - (32%) Gaps:176/410 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAG-------CKVSEHCAKH 74
            |||.:|      .:...||....:|           ||   :||||||       .::.:|....
  Rat   127 GEGLQL------KENSESEGISCHY-----------WS---LFDGHAGSGAAVVASRLLQHHITQ 171

  Fly    75 LLESIIS---------------------------------------------------TEEFIGG 88
            .|:.|:.                                                   ||:.|  
  Rat   172 QLQDIVEILKNSAILPPTCLGEEPESTPAHGRTLTRAASLRGGVGAPGSPSTPPTRFFTEKKI-- 234

  Fly    89 DH----VKGIRTGFLRID-EVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQ 148
            .|    :..:.:.|..:| ::.||...:...    ||.||:.....|.::|:||.|||||::.|.
  Rat   235 PHECLVIGALESAFKEMDLQIERERSAYNIS----GGCTALIVVCLLGKLYVANAGDSRAIIIRN 295

  Fly   149 G--VPV---FATQDHKPIL--------------------PEEKER-------------------- 168
            |  :|:   |..:..:..|                    |...:|                    
  Rat   296 GEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLYRDFNMTGWAYK 360

  Fly   169 -----------IYNAGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI----FCQ 218
                       ||..|...   ||..|:.|:|.|||:|.|........:..:|..||:    ..:
  Rat   361 TIEDDDLKFPLIYGEGKKA---RVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRVYDLSK 422

  Fly   219 SRQDSDEFLVLACDGIWDVMSNEDVCSFI------------HSRMRVTSNLVSIANQVV------ 265
            ....:|:.|:||.||:|||:|||:|...|            |.......:||..|..|:      
  Rat   423 YEHGADDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWR 487

  Fly   266 ---DTCLHKGSRDNMSIIII 282
               |   ..||.|::|:.:|
  Rat   488 ISND---RLGSGDDISVYVI 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 83/403 (21%)
PP2C_C 278..352 CDD:285117 2/5 (40%)
Ppm1hNP_001258008.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 110..133 4/11 (36%)
PP2Cc 142..506 CDD:238083 81/389 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.