DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ppm1k

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001101333.1 Gene:Ppm1k / 312381 RGDID:1308501 Length:372 Species:Rattus norvegicus


Alignment Length:289 Identity:88/289 - (30%)
Similarity:140/289 - (48%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCA 72
            ||.:..|         .|.:|:.|.|.|.||    |.|......:..:|||:|||.|...::.|.
  Rat    88 PKISLEN---------VGCASLIGKRKENED----RFGFAQLTEEVLYFAVYDGHGGPAAADFCH 139

  Fly    73 KHL---LESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRE-SEKCGGTTAVCAFV--GLT 131
            .|:   :..::..|:    |....:...||.||:........:.: |....||||..|.:  |: 
  Rat   140 THMEKCVTDLLPREK----DLETVLTLAFLEIDKAFSSYAHLSADASLLTSGTTATVALLRDGV- 199

  Fly   132 QVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGG-----SVMIKRVNGTLAVSRAL 191
            ::.:|:.|||||:|||:|.|:..|.||.|...:|||||...||     |:....|||.||::|::
  Rat   200 ELVVASVGDSRALLCRKGKPMKLTTDHTPERKDEKERIKKCGGFVAWNSLGQPHVNGRLAMTRSI 264

  Fly   192 GDYDFKNVKEKGQCEQLVSPEPEIF-CQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTS 255
            ||.|   :|..|     |..|||.. .:.....|.||||..|||..:::::::|.|::.    ..
  Rat   265 GDLD---LKASG-----VIAEPETTRIKLYHADDSFLVLTTDGINFMVNSQEICDFVNQ----CH 317

  Fly   256 NLVSIANQVVDTCLHKGSRDNMSIIIIAF 284
            :....|:.|.:..:..|:.||.:.:::.|
  Rat   318 DPKEAAHAVTEQAIQYGTEDNSTAVVVPF 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 84/271 (31%)
PP2C_C 278..352 CDD:285117 1/7 (14%)
Ppm1kNP_001101333.1 PP2Cc 95..346 CDD:238083 84/271 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.