DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Pptc7

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001100611.1 Gene:Pptc7 / 304488 RGDID:1310383 Length:307 Species:Rattus norvegicus


Alignment Length:204 Identity:37/204 - (18%)
Similarity:73/204 - (35%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELP 109
            |:.|.:..|..:.|........:...|     |.::....|:..:.|..:.|.:..:  :..::|
  Rat    78 GVADGVGGWRDYGVDPSQFSGTLMRTC-----ERLVKEGRFVPSNPVGILTTSYCEL--LQNKVP 135

  Fly   110 EFTRESEKCGGTTAVCAFV---GLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYN 171
            ..        |::..|..|   ...:::.||.|||..::.|.|..|     |:   .:|::..:|
  Rat   136 LL--------GSSTACIVVLDRSSHRLHTANLGDSGFLVVRGGEVV-----HR---SDEQQHYFN 184

  Fly   172 AGGSVMIKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEF-------LVL 229
            ....:       ::|...|.|              .::|..|:     ..||..|       ::.
  Rat   185 TPFQL-------SIAPPEAEG--------------VVLSDSPD-----AADSTSFDVQLGDIILT 223

  Fly   230 ACDGIWDVM 238
            |.||::|.|
  Rat   224 ATDGLFDNM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 37/204 (18%)
PP2C_C 278..352 CDD:285117
Pptc7NP_001100611.1 PP2Cc 63..299 CDD:412173 37/204 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.