DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ppm1j

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_008759602.1 Gene:Ppm1j / 295341 RGDID:1359104 Length:522 Species:Rattus norvegicus


Alignment Length:412 Identity:84/412 - (20%)
Similarity:140/412 - (33%) Gaps:164/412 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AKHNDEG--------EGNKLLFGV----SSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHA 63
            ::||::.        |..:.:.||    |..||:      ::|             ::.:|||||
  Rat   133 SRHNEDQACCEVVYVESRRSITGVSREPSHNQGF------SFY-------------YWGLFDGHA 178

  Fly    64 GCKVSEHCA----KHLLESIISTEEFIGG-----------------------------------D 89
            |...:|..:    :|:.|.:....|.:..                                   .
  Rat   179 GGGAAEMASRLLHRHIREQLKDLVEILQDPLPPPLCLPSTPGTPGVSSPSQLVSPQSWSPQKEVT 243

  Fly    90 H----VKGIRTGFLRIDEVM-RELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQG 149
            |    |..|...|..:||.| ||......|    ||..|:.....|.::|:||.|||||::.|.|
  Rat   244 HDSLVVGAIENAFQLMDEQMARERRGHLVE----GGCCALVVVYLLGKMYVANAGDSRAIIVRNG 304

  Fly   150 VPVFATQDHKPILPEEKERIYNAG-------------------------GSVMI----------- 178
            ..:..:::..|  ..|::|:...|                         |..|:           
  Rat   305 EIIPMSREFTP--ETERQRLQLLGFLKPELLGSEFTHLEFPRRVQPKELGQRMLYRDQNMTGWAY 367

  Fly   179 -------------------KRVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEI----FCQSR 220
                               .||..|:.|:|.|||::.|........:..:|..||:    ..|..
  Rat   368 KKIELEDLRFPLVCGEGKKARVMATIGVTRGLGDHNLKVCSSTLPIKPFLSCFPEVRVYDLTQYE 432

  Fly   221 QDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVT------SNLVSIANQVV-------------- 265
            ...|:.|||..||:|||.::.:|.:.: .|:..|      |...::|..:|              
  Rat   433 HCPDDVLVLGTDGLWDVTNDSEVAATV-DRVLSTYEPNDPSRYTALAQALVLGARGIPRDRGWRL 496

  Fly   266 -DTCLHKGSRDNMSIIIIAFPG 286
             :..|  ||.|::|:.:|...|
  Rat   497 PNNKL--GSGDDISVFVIPLGG 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 80/387 (21%)
PP2C_C 278..352 CDD:285117 3/9 (33%)
Ppm1jXP_008759602.1 PP2Cc 123..514 CDD:238083 83/408 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.