DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and ptc2

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_588356.1 Gene:ptc2 / 2539252 PomBaseID:SPCC1223.11 Length:370 Species:Schizosaccharomyces pombe


Alignment Length:293 Identity:114/293 - (38%)
Similarity:162/293 - (55%) Gaps:11/293 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGGFLDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGD---ALPDWSFFAVFDGH 62
            ||..|.:|...||:..|....|.||||.|||||..||||:.|.....|   :.|..|||.|||||
pombe     1 MGQTLSEPVLDKHSSSGGDRWLHFGVSHMQGWRISMEDAHCALLNFTDSNSSNPPTSFFGVFDGH 65

  Fly    63 AGCKVSEHCAKHLLESIISTEEFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCGGTTAVCAF 127
            .|.:|:::|.:||.:.|.|...|..|::.:.:::|||..|..:.:..:...:...|..|||:  .
pombe    66 GGDRVAKYCRQHLPDIIKSQPSFWKGNYDEALKSGFLAADNALMQDRDMQEDPSGCTATTAL--I 128

  Fly   128 VGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKRVNGTLAVSRALG 192
            |....:|.||.||||.||.|:|.....:.||||....||.||..|||.:...||||:||:|||:|
pombe   129 VDHQVIYCANAGDSRTVLGRKGTAEPLSFDHKPNNDVEKARITAAGGFIDFGRVNGSLALSRAIG 193

  Fly   193 DYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNL 257
            |:::|........:|:|:..|::...:....||||:||||||||..|::.|..|:...:....:|
pombe   194 DFEYKKDSSLPPEKQIVTAFPDVVIHNIDPDDEFLILACDGIWDCKSSQQVVEFVRRGIVARQSL 258

  Fly   258 VSIANQVVDTCLHKGSR------DNMSIIIIAF 284
            ..|...::|.|:...|.      |||:|.|:||
pombe   259 EVICENLMDRCIASNSESCGIGCDNMTICIVAF 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 104/268 (39%)
PP2C_C 278..352 CDD:285117 4/7 (57%)
ptc2NP_588356.1 PP2C 22..278 CDD:278884 100/257 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoFinder 1 1.000 - - FOG0000692
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 1 1.000 - - X444
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.