DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Pdp2

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_659559.2 Gene:Pdp2 / 246311 RGDID:628812 Length:530 Species:Rattus norvegicus


Alignment Length:423 Identity:101/423 - (23%)
Similarity:159/423 - (37%) Gaps:135/423 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DEGEGNKLLFGVSSMQGWRSEMEDAYYARAGLGDALPD-WSFFAVFDGHAG--C--KVSEHCAKH 74
            :.|..|.:|...|:.....|.:||    |.|:...:.. .:.|.:||||.|  |  .|||....:
  Rat   100 NSGVPNSVLRFESNQLAANSPVED----RQGVASCVQTRGTMFGIFDGHGGHACAQAVSERLFYY 160

  Fly    75 LLESIIS------TEEFIGG---------------------------DHVK-------------G 93
            :..|::|      .||.:..                           ||::             |
  Rat   161 MAVSLMSHKTLEQMEEAMENMKPLLPILQWLKHPGDSIYKDITSVHLDHLRVYWQELLDLHMETG 225

  Fly    94 IRT------GFLRID-----EVMREL-PEFTRE---SEKCGGTTAVCAFVGLTQVYIANCGDSRA 143
            :.|      .|.|:|     |:...| .|.|:.   .....|.||..|.|....::|||.||.||
  Rat   226 LSTEEALMYSFQRLDSDISLEIQAPLEDEVTKNLSLQVAFSGATACMAHVDGVHLHIANAGDCRA 290

  Fly   144 VLCRQG-------VPVFATQDH-----------KPILPEEKERIYNAGGSVMIKRVNGTLAVSRA 190
            :|..||       :|:  |.||           |...||.::|..     ::..|:.|.|...||
  Rat   291 ILGVQGDNGAWSCLPL--TCDHNAWNEAELSRLKREHPESEDRTL-----IIDDRLLGVLLPCRA 348

  Fly   191 LGDYDFK-------NVKEKG-QCEQL---------------VSPEPEIFCQSRQDSDEFLVLACD 232
            .||...|       ||.|:| ..|.|               ::.:||:.....:..|:|||||.|
  Rat   349 FGDVQLKWSKELQRNVLERGFDTEALNIYQFTPPHYHTPPYLTAKPEVTYHRLRPQDKFLVLASD 413

  Fly   233 GIWDVMSNEDVCSFI--------HSRMRV------TSNLVSIANQVVDTCLHKGSRDNMSIIIIA 283
            |:||::.||||...:        |.:..:      ..::.|:..|...:.||...::..:.:|..
  Rat   414 GLWDMLDNEDVVRLVVGHLSKVGHQKPALDQRPANLGHMQSLLLQRKASGLHAADQNAATHLIRH 478

  Fly   284 FPGAPKPTE---EAIEAEHRLEKQIEKITRDEI 313
            ..|:.:..|   |.:.|...|.:.:.::.||:|
  Rat   479 AIGSNEYGEMEPERLAAMLTLPEDVARMYRDDI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 90/380 (24%)
PP2C_C 278..352 CDD:285117 9/39 (23%)
Pdp2NP_659559.2 PP2Cc 96..516 CDD:214625 101/423 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338448
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.