DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Ppm1l

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_848841.2 Gene:Ppm1l / 242083 MGIID:2139740 Length:360 Species:Mus musculus


Alignment Length:283 Identity:95/283 - (33%)
Similarity:138/283 - (48%) Gaps:33/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH 90
            |.|:||.|..|||.:.....|.:.... |.|.:||||.|...:|:....|.|::....:....|.
Mouse    95 VYSIQGRRDHMEDRFEVLTDLANKTHP-SIFGIFDGHGGETAAEYVKSRLPEALKQHLQDYEKDK 158

  Fly    91 VKGIRT-------GFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLC-R 147
            ...:.|       ..|.||   ||:.|....|....|||.:.|.:....:.:||.||||.||| :
Mouse   159 ENSVLTYQTILEQQILSID---REMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDK 220

  Fly   148 QGVPVFATQDHKPILPEEKERIYNAGGSVMIK---RVNGTLAVSRALGDYDFKNVKEKGQCEQLV 209
            .|..:..:.||||...:|::||..|||.:...   ||.|.||:||:||||..||:       .:|
Mouse   221 DGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNL-------NVV 278

  Fly   210 SPEPEIFCQSRQDSD----EFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCLH 270
            .|:|:|.   ..|.|    ||::||.||:||..|||:...||..|:   ......|..:|....:
Mouse   279 IPDPDIL---TFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERL---DEPHFGAKSIVLQSFY 337

  Fly   271 KGSRDNMSIIIIAFPGAPKPTEE 293
            :|..||::::::.|..:.| |||
Mouse   338 RGCPDNITVMVVKFRNSSK-TEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 90/272 (33%)
PP2C_C 278..352 CDD:285117 5/16 (31%)
Ppm1lNP_848841.2 PP2Cc 93..351 CDD:238083 90/272 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.