DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and tap-1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_510428.1 Gene:tap-1 / 181556 WormBaseID:WBGene00006524 Length:386 Species:Caenorhabditis elegans


Alignment Length:262 Identity:54/262 - (20%)
Similarity:94/262 - (35%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 TGFLRIDEVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKP 160
            ||...:.|:.:::.:         ||||:...:....:|:.|||:|.|:.......|        
 Worm   128 TGNNAVSEINQKIRQ---------GTTAIVVMIINQDLYVLNCGNSLAIAMNSENVV-------- 175

  Fly   161 ILPEEKERIYNAGGSVMIKRVNG-------TLAVSRALGDYD----------FKNVKEKGQCEQL 208
               :....::|....:.|.|:.|       .|..:||:||..          |||.|...     
 Worm   176 ---QLNSNLHNNDNPLEIVRIKGLGINPETVLNPTRAIGDLQRTHLFEETEAFKNAKGPP----- 232

  Fly   209 VSPEPEIFCQSRQDSDEFLVLACDGIWDVMSN---EDVCSFIHSRMRVTSNLVSIANQVVDTCLH 270
            |...|::.......|...|||..||:...:..   |::.:.:..|:.....:.|.|..:||:...
 Worm   233 VISTPDVQYTKIDPSWRHLVLISDGVVQNLKEVEVENIPTEVSVRLIEDHTVTSTAQALVDSFAR 297

  Fly   271 K----------------GSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEIESSKIT 319
            |                ..|:.|::|.:..       ||..:|  .|.:|.:... ..:||:..|
 Worm   298 KHRDAYTMSDDKNFCISNHREEMTVIYVKL-------EEDYQA--ALYEQFDSAI-STMESTNAT 352

  Fly   320 DY 321
            .|
 Worm   353 LY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 45/223 (20%)
PP2C_C 278..352 CDD:285117 10/44 (23%)
tap-1NP_510428.1 PP2Cc 21..327 CDD:238083 45/223 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47992
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.