DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and W09D10.4

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_499362.1 Gene:W09D10.4 / 176497 WormBaseID:WBGene00012362 Length:330 Species:Caenorhabditis elegans


Alignment Length:282 Identity:56/282 - (19%)
Similarity:101/282 - (35%) Gaps:84/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GF----LDKPKTAKHNDEGEGNKLLFGVSSMQGWRSEMEDAYYAR-------AGLGDALPDWSFF 56
            ||    |:.|.|..  |:|     :||           :||::..       .|:.|.:..|..:
 Worm    75 GFPKDMLNGPSTVL--DKG-----VFG-----------DDAWFISRFKNTFVVGVADGVGGWRKY 121

  Fly    57 AVFDGHAGCKVSEHCAKHLLESIISTE--EFIGGDHVKGIRTGFLRIDEVMRELPEFTRESEKCG 119
            .:.......::.:.|.|.:.:.....:  |.:              :|...|...|..|   ..|
 Worm   122 GIDPSAFSRRLMKECEKRVQKGDFDPQKPESL--------------LDYAFRASAEAPR---PVG 169

  Fly   120 GTTAVCAFVGLTQVYIANCGDSRAVLCRQGVPVFATQDHKPILPEEKERI--YNAGGSVMI--KR 180
            .:||....|...::|.||.|||..::.|.|          .|:.:.:|::  :||...:.:  :.
 Worm   170 SSTACVLVVHQEKLYSANLGDSGFMVVRNG----------KIVSKSREQVHYFNAPFQLTLPPEG 224

  Fly   181 VNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCS 245
            ..|.:.....:.|.|...|| ||                     :.::||.||:||.:|.:.|..
 Worm   225 YQGFIGDKADMADKDEMAVK-KG---------------------DIILLATDGVWDNLSEQQVLD 267

  Fly   246 FIHSRMRVTSNLVSIANQVVDT 267
            .:.:.....||:..:.|.:..|
 Worm   268 QLKALDAGKSNVQEVCNALALT 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 49/257 (19%)
PP2C_C 278..352 CDD:285117
W09D10.4NP_499362.1 PP2Cc 72..327 CDD:214625 56/282 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.