DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and fem-2

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_497224.1 Gene:fem-2 / 175217 WormBaseID:WBGene00001412 Length:449 Species:Caenorhabditis elegans


Alignment Length:315 Identity:90/315 - (28%)
Similarity:143/315 - (45%) Gaps:58/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 MQGWRSEMEDAY--YARAGLGDALPD-WSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIG-GD 89
            ::|.|.:.||.:  |......|...| .|..||||||.|.:.|::.|.||.|:.:...:... .|
 Worm   168 LKGQRHKQEDRFLAYPNGQYMDRGEDPISVLAVFDGHGGHECSQYAAGHLWETWLEVRKSRDPSD 232

  Fly    90 HVKG-IRTGFLRIDEVMRELPEFTRESEKC--GGTTAVCAFVGLTQ--VYIANCGDSRAVLC--- 146
            .::. :|.....:||.|.     .|..::|  ||:||||..:.:.|  :.:|..|||...:.   
 Worm   233 SLEDQLRKSLELLDERMT-----VRSVKECWKGGSTAVCCAIDMDQKLMALAWLGDSPGYVMSNI 292

  Fly   147 --RQGVPVFATQDHKPILPEEKERIYNAGGSVMI----KRVNGTLAVSRALGDYDFKNVKEKGQC 205
              ||     .|:.|.|....|..|:..|||.:.:    .||||.|.::|||||...:        
 Worm   293 EFRQ-----LTRGHSPSDEREARRVEEAGGQLFVIGGELRVNGVLNLTRALGDVPGR-------- 344

  Fly   206 EQLVSPEPEIFCQSRQDSDEFLV-LACDGIWDVMSNEDVCSFIHSRMR--VTSNLVSIANQVVDT 267
             .::|.|||. ||...:|.::|| ||||||.||.:..|:...:.:...  ...:...::..:...
 Worm   345 -PMISNEPET-CQVPIESSDYLVLLACDGISDVFNERDLYQLVEAFANDYPVEDYAELSRFICTK 407

  Fly   268 CLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQIEKITRDEI--ESSKITD 320
            .:..||.||:|::|    |..:|.::           :.|:.:.|.  |.|.:||
 Worm   408 AIEAGSADNVSVVI----GFLRPPQD-----------VWKLMKHESDDEDSDVTD 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 82/275 (30%)
PP2C_C 278..352 CDD:285117 10/45 (22%)
fem-2NP_497224.1 PP2C 161..417 CDD:278884 79/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.