DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PPM1L

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_640338.2 Gene:PPM1L / 151742 HGNCID:16381 Length:360 Species:Homo sapiens


Alignment Length:284 Identity:93/284 - (32%)
Similarity:138/284 - (48%) Gaps:35/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VSSMQGWRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLESIISTEEFIGGDH 90
            |.|:||.|..|||.:.....|.:.... |.|.:||||.|...:|:....|.|::....:    |:
Human    95 VYSIQGRRDHMEDRFEVLTDLANKTHP-SIFGIFDGHGGETAAEYVKSRLPEALKQHLQ----DY 154

  Fly    91 VKGIRTGFLRIDEVM--------RELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLC- 146
            .|......|....::        ||:.|....|....|||.:.|.:....:.:||.||||.||| 
Human   155 EKDKENSVLSYQTILEQQILSIDREMLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCD 219

  Fly   147 RQGVPVFATQDHKPILPEEKERIYNAGGSVMIK---RVNGTLAVSRALGDYDFKNVKEKGQCEQL 208
            :.|..:..:.||||...:|::||..|||.:...   ||.|.||:||:||||..||:       .:
Human   220 KDGNAIPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNL-------NV 277

  Fly   209 VSPEPEIFCQSRQDSD----EFLVLACDGIWDVMSNEDVCSFIHSRMRVTSNLVSIANQVVDTCL 269
            |.|:|:|.   ..|.|    ||::||.||:||..|||:...||..|:   ......|..:|....
Human   278 VIPDPDIL---TFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERL---DEPHFGAKSIVLQSF 336

  Fly   270 HKGSRDNMSIIIIAFPGAPKPTEE 293
            ::|..||::::::.|..:.| |||
Human   337 YRGCPDNITVMVVKFRNSSK-TEE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 88/273 (32%)
PP2C_C 278..352 CDD:285117 5/16 (31%)
PPM1LNP_640338.2 PP2Cc 93..351 CDD:238083 88/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53745
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.