DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PP2D1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001239586.1 Gene:PP2D1 / 151649 HGNCID:28406 Length:630 Species:Homo sapiens


Alignment Length:439 Identity:83/439 - (18%)
Similarity:154/439 - (35%) Gaps:142/439 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCAKHL--------------------L 76
            |:::|.|.:...:..|:. |:..||.:||||.|...:|..:..|                    .
Human   181 WKADMNDKFTVVSNFGNK-PNVCFFGLFDGHHGASAAELTSMELPVLLLHQLSKFDPSYQMTTDE 244

  Fly    77 ESIIST------EEFIG------------------GDHVKGIRTGFLRIDEVM----RELPEFTR 113
            :.||::      ||:..                  .|..|.....|.|:|.::    :|:...  
Human   245 QQIINSFYTVFREEYAAIEDLFSAINKTEAVRCEYEDTHKAFAKAFWRMDRLLGLGRKEVSRV-- 307

  Fly   114 ESEKCGGTTAVCAFV--------------------GLTQ--------------VYIANCGDSRAV 144
               :..|.:||...:                    ||.:              :::||.|:.:||
Human   308 ---QWSGCSAVTCILEGKPKSPYAHKNWKRKNTHDGLAESSPSQEMPKIISGILHVANTGNVQAV 369

  Fly   145 LCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIKR----VNGTLAVSRALGDYDFKNVKEKGQC 205
            |||.|.....|::|......|:.||...|..:....    |.|.:..:|.||.:.  |:|.|   
Human   370 LCRNGKGFCLTKEHTTRNTNERRRILQNGAVISSNEPYGLVEGQVKTTRGLGFHG--NLKLK--- 429

  Fly   206 EQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSF----IHSRMRVTSNLVSIANQVVD 266
             :.:.|.|:.......|..:||::|.:|:|:|:..|:|.:.    .|........::...:....
Human   430 -KSIIPAPQTISVPIDDLCQFLIVATNGLWEVLDKEEVTALAMTTFHMYKETYCPIIPNKSPSKG 493

  Fly   267 TCLHKGSRDNM----SIIIIAFPGAPKPTEEAIEAEHRLEKQIEKIT---RDEIESSKITDYVDL 324
            ..|...|..|:    |.|.:.|             :::...::...|   ::.:..|..:.|   
Human   494 PLLFSTSEPNLTKSQSNIHVLF-------------QYKSVSEVRVSTTNSKENLSDSNYSKY--- 542

  Fly   325 LKCLQNRDDIEGLPPGGGLQSKYHVIERTFK----QEFPDRPCEGNGIS 369
              |:.|.:::|..|           .|.|.:    ::..|||...|.::
Human   543 --CIYNPENVETFP-----------AETTHRKPCSEKVTDRPTSVNDVA 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 69/345 (20%)
PP2C_C 278..352 CDD:285117 10/76 (13%)
PP2D1NP_001239586.1 PP2Cc 181..466 CDD:238083 62/296 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 557..578 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144757
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.