DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and PPM1M

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_653242.3 Gene:PPM1M / 132160 HGNCID:26506 Length:459 Species:Homo sapiens


Alignment Length:342 Identity:82/342 - (23%)
Similarity:131/342 - (38%) Gaps:128/342 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FFAVFDGHAG-------CKVSEHCAKHLLESII-------------------STEEFIGGDHVKG 93
            ::|:||||.|       ......|.:..||:::                   |..:|:   ..||
Human   120 YWALFDGHGGPAAAILAANTLHSCLRRQLEAVVEGLVATQPPMHLNGRCICPSDPQFV---EEKG 181

  Fly    94 IR----------TGFLRIDEVM-RELPEFTRESEKCGGTTAVCAFVGLTQVYIANCGDSRAVLCR 147
            ||          :.|...|||: |||    ..|.:.||.||:.|.....::|:||.|||||:|.|
Human   182 IRAEDLVIGALESAFQECDEVIGREL----EASGQMGGCTALVAVSLQGKLYMANAGDSRAILVR 242

  Fly   148 QGVPVFATQDHKPI----LPE-EKERIY--------------------------NAGGSVMIK-- 179
            :       .:.:|:    .|| |::||.                          :.|..|:.:  
Human   243 R-------DEIRPLSFEFTPETERQRIQQLAFVYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDH 300

  Fly   180 ---------------------------RVNGTLAVSRALGDYDFKNVKEKGQCEQLVSPEPEIFC 217
                                       |:.|||||||.|||:..:.:....|.:..:...|::..
Human   301 HMSGWSYKRVEKSDLKYPLIHGQGRQARLLGTLAVSRGLGDHQLRVLDTNIQLKPFLLSVPQVTV 365

  Fly   218 ----QSRQDSDEFLVLACDGIWDVMSNEDVC----SFI-------HSRMRVTSNLVSIANQVVDT 267
                |.....|:.:|:|.||:|||:|||.|.    ||:       |...::...|:.......|:
Human   366 LDVDQLELQEDDVVVMATDGLWDVLSNEQVAWLVRSFLPGNQEDPHRFSKLAQMLIHSTQGKEDS 430

  Fly   268 CLHKG--SRDNMSIIII 282
            ...:|  |.|::|:.:|
Human   431 LTEEGQVSYDDVSVFVI 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 82/342 (24%)
PP2C_C 278..352 CDD:285117 2/5 (40%)
PPM1MNP_653242.3 PP2Cc 118..449 CDD:238083 82/342 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144737
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.