DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and Pp2d1

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_775625.1 Gene:Pp2d1 / 110332 MGIID:3612067 Length:620 Species:Mus musculus


Alignment Length:297 Identity:58/297 - (19%)
Similarity:109/297 - (36%) Gaps:89/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 WRSEMEDAYYARAGLGDALPDWSFFAVFDGHAGCKVSEHCA------------------------ 72
            |::|....:......||. .:..||.:||.|.|...::..:                        
Mouse   184 WKAEPNCKFTVVNDFGDK-ANVCFFGLFDSHYGYAAADLASKEFQVLLLHQLSIQDPSYQMTAEQ 247

  Fly    73 KHLLESI--ISTEEFIGGDHV-----KGIRT--------------GFLRIDEVMR---------- 106
            |.|:.|.  :..||:...:..     |..||              .|.|:|.::|          
Mouse   248 KQLINSFDTVFREEYRAREEAFSSTYKTFRTSRREYEDTHKAFAKAFWRMDRLLRLGRNETSRVR 312

  Fly   107 ---------------ELPEFTRESEKC--GGTTAVCAFVGLTQV-----YIANCGDSRAVLCRQG 149
                           :.|...::.||.  .|:|:: .|....|:     ::||.|:.:|||||.|
Mouse   313 WSGCSALTCILEGGIKNPHANKDWEKTYQQGSTSL-PFQKTPQIISGVLHLANAGNVQAVLCRNG 376

  Fly   150 VPVFATQDHKPILPEEKERIYNAGGSVM----IKRVNGTLAVSRALGDYDFKNVKEKGQCEQLVS 210
            .....|::|.....:|:.|:..:...:.    ...::|.:..:|.||.:....:|:.      :.
Mouse   377 KGFCLTKEHSTRNTKERRRVLYSEAVISSDDPYGLLDGHIKTTRGLGFHGNLRLKKS------II 435

  Fly   211 PEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFI 247
            |.|:.......|..:||:||.:|:|.|:..::|.:.:
Mouse   436 PAPQTISVPIDDLCQFLILATNGLWQVLDKKEVTALV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 58/297 (20%)
PP2C_C 278..352 CDD:285117
Pp2d1NP_775625.1 PP2Cc 187..472 CDD:238083 57/292 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167834869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0631
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.