DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alph and ppm1f

DIOPT Version :9

Sequence 1:NP_651701.1 Gene:alph / 43481 FlyBaseID:FBgn0086361 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_002931930.1 Gene:ppm1f / 100380003 XenbaseID:XB-GENE-948958 Length:429 Species:Xenopus tropicalis


Alignment Length:300 Identity:95/300 - (31%)
Similarity:153/300 - (51%) Gaps:33/300 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 NKLLFGVSSMQGWRSEMEDAYYARA------GLGDALPDWSFFAVFDGHAGCKVSEHCAKHLLES 78
            ::|...|.:::..|.:|||.:....      |:.|::|. |:|||||||.|...:.:.:.::..:
 Frog   130 HELCVSVHAIRNTRRKMEDRHVILQDFNMLFGIKDSIPR-SYFAVFDGHGGVDAANYASTYVHVN 193

  Fly    79 IISTEEFIGGDHVKGIRTGFLRID-----EVMRELPEFTRESEKCGGTTAVCAFVGLTQVYIANC 138
             ::..|.:..|..:.:|..|.|.|     :..||:|...      .|||.||..:...:.::|..
 Frog   194 -VARHEGLEQDPAQALRESFQRTDAMFLKKAKREIPRLR------SGTTGVCILLEGDRFHVAWL 251

  Fly   139 GDSRAVLCRQGVPVFATQDHKPILPEEKERIYNAGGSVMIK---RVNGTLAVSRALGDYDFKNVK 200
            |||:|:|.|||..|.....|||...:|:|||.:.||.|...   |||||||||||:||.|.|   
 Frog   252 GDSQALLVRQGNYVTLMDPHKPERKDERERIESLGGCVAFMGCWRVNGTLAVSRAIGDIDQK--- 313

  Fly   201 EKGQCEQLVSPEPEIFCQSRQDSDEFLVLACDGIWDVMSNEDVCSFIHSRMRVT-SNLVSIANQV 264
                  ..||.|.::.......:::||||||||.:|.:|..:|...:...::.. .|...:|.::
 Frog   314 ------PFVSGEGDVTSHILSGTEDFLVLACDGFYDTVSPPEVPRLVFDYLQENGGNWQHVAERL 372

  Fly   265 VDTCLHKGSRDNMSIIIIAFPGAPKPTEEAIEAEHRLEKQ 304
            |......||.||:::::: |...|:...|.|:|:..:|.|
 Frog   373 VTVAKEGGSSDNITVVVV-FLKHPQKLLEDIQAQGSVEGQ 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alphNP_651701.1 PP2Cc 24..284 CDD:238083 87/274 (32%)
PP2C_C 278..352 CDD:285117 6/26 (23%)
ppm1fXP_002931930.1 PP2Cc 134..392 CDD:238083 87/275 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R955
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.