DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7567 and CG34005

DIOPT Version :9

Sequence 1:NP_651699.1 Gene:CG7567 / 43479 FlyBaseID:FBgn0039670 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001033957.2 Gene:CG34005 / 3885597 FlyBaseID:FBgn0054005 Length:185 Species:Drosophila melanogaster


Alignment Length:151 Identity:41/151 - (27%)
Similarity:68/151 - (45%) Gaps:24/151 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GTSVRCFDYYIPIINGLSAQYELDYNKCVK-----------DYDTASELVLAAWNSTLFGIQASG 108
            |.:.:||..|:|.:....|.:...||.|.|           |...|.|.:..|            
  Fly    41 GNTKKCFARYLPELESEGATWSQGYNACQKITINERLSLLTDATEAQEEIREA------------ 93

  Fly   109 DRGCNTFFD-CSSIVDFVLAFECFANVGAEQSKIMYQVSANATEAAVQIKIHLQTLDSQLESCLN 172
            ..|.::|.| |..:.:.|..|.|||.:...|...:|.:|.||||.|:.:...|..::.:...|.|
  Fly    94 ALGISSFIDQCLVLTEAVDFFNCFAKMAKLQLANVYSISFNATEQALILNKKLSRIELEHYRCTN 158

  Fly   173 YSEKDFVEGTSLYYGELNKCL 193
            .:|:::|:||:..:..|::||
  Fly   159 QTEQNYVKGTNTIFRSLDQCL 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7567NP_651699.1 DUF725 56..176 CDD:283039 33/131 (25%)
CG34005NP_001033957.2 DUF725 42..162 CDD:283039 33/131 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C51E
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006718
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.