Sequence 1: | NP_996303.1 | Gene: | Trc8 / 43476 | FlyBaseID: | FBgn0039668 | Length: | 809 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010427.3 | Gene: | SAN1 / 851721 | SGDID: | S000002550 | Length: | 610 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 233 | Identity: | 45/233 - (19%) |
---|---|---|---|
Similarity: | 86/233 - (36%) | Gaps: | 82/233 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 636 CRHFFHGVCLRKWLYVQDRCPLCHEIM---MYTDKADENAPEAEPAPAAQAEQPMRIYPRDDANN 697
Fly 698 AAAQRRSPERAPVEASEQAPATSSSSAAATIGAEAVSAIVESAAAVGEA---------------- 746
Fly 747 -------------RSLVSVASSSSATHRISASGSSDS----------SYMTASAQSPPPTATSAA 788
Fly 789 AVATAA----ASNTT----------------HMFRMSQ 806 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Trc8 | NP_996303.1 | TRC8_N | 122..590 | CDD:290425 | |
zf-rbx1 | <618..659 | CDD:289448 | 9/22 (41%) | ||
zf-RING_2 | 619..659 | CDD:290367 | 9/22 (41%) | ||
SAN1 | NP_010427.3 | HRD1 | <242..424 | CDD:227568 | 34/186 (18%) |
zf-RING_2 | <251..280 | CDD:404518 | 9/22 (41%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5243 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |