DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and SAN1

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_010427.3 Gene:SAN1 / 851721 SGDID:S000002550 Length:610 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:45/233 - (19%)
Similarity:86/233 - (36%) Gaps:82/233 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 CRHFFHGVCLRKWLYVQDRCPLCHEIM---MYTDKADENAPEAEPAPAAQAEQPMRIYPRDDANN 697
            |.|.|...|:.||..:::.||||.:.:   :...:|.:...:...|..|..|:..|:.....|.|
Yeast   257 CGHIFGRECIYKWSRLENSCPLCRQKISESVGVQRAAQQDTDEVAANEAAFERIRRVLYDPTAVN 321

  Fly   698 AAAQRRSPERAPVEASEQAPATSSSSAAATIGAEAVSAIVESAAAVGEA---------------- 746
            :..:..|   ||.|       .:|::...|||          .|:.||.                
Yeast   322 STNENSS---APSE-------NTSNTTVPTIG----------NASSGEQMLSRTGFFLVPQNGQP 366

  Fly   747 -------------RSLVSVASSSSATHRISASGSSDS----------SYMTASAQSPPPTATSAA 788
                         |:.|:..||::.....::.||:::          :.....:.:|.|:|:.::
Yeast   367 LHNPVRLPPNDSDRNGVNGPSSTTQNPPSNSGGSNNNQSPRWVPIPLTLFQFHSPNPNPSASDSS 431

  Fly   789 AVATAA----ASNTT----------------HMFRMSQ 806
            |..:||    ::||:                |:|.::|
Yeast   432 ASPSAANGPNSNNTSSDATDPHHNRLRAVLDHIFNVAQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425
zf-rbx1 <618..659 CDD:289448 9/22 (41%)
zf-RING_2 619..659 CDD:290367 9/22 (41%)
SAN1NP_010427.3 HRD1 <242..424 CDD:227568 34/186 (18%)
zf-RING_2 <251..280 CDD:404518 9/22 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.