DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and RNFT2

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_001103373.1 Gene:RNFT2 / 84900 HGNCID:25905 Length:444 Species:Homo sapiens


Alignment Length:323 Identity:66/323 - (20%)
Similarity:120/323 - (37%) Gaps:94/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 SLGTVSAVLFYILALQTGLTSLSPDKRFIRLCRNLCLLMTALLHFLHNIVSPILMSLSA----AR 451
            :|..:.||:.:   ||.||.       ||       |::.|.|.|.|.:...:.:.:::    |.
Human   152 ALSELKAVICW---LQKGLP-------FI-------LILLAKLCFQHKLGIAVCIGMASTFAYAN 199

  Fly   452 NPSR-------KRHVRA-LSVCAFLVVLSVSLLYHLWSQQSIST-----------------WLLA 491
            :..|       ||.|.. |.:.|||...::.:||...|||..::                 |::.
Human   200 STLREQVSLKEKRSVLVILWILAFLAGNTLYVLYTFSSQQLYNSLIFLKPNLEMLDFFDLLWIVG 264

  Fly   492 VTAFSVEVVV-----------KVLVSLATYTLF--LLDARRQFFWEKLDDYLYYVRAFGNSVEFC 543
            :..|.::.:.           |:::::.:...|  :::...|.|...:...|:|....|:.....
Human   265 IADFVLKYITIALKCLIVALPKIILAVKSKGKFYLVIEELSQLFRSLVPIQLWYKYIMGDDSSNS 329

  Fly   544 FGILLFINGAWILIFESAQN----ATGGGIRAI--MMCIHAYFNIWCEARAGWSVFMKRRSAVHK 602
            :    |:.|..|:::...::    ...||:|..  ::|....:.:                    
Human   330 Y----FLGGVLIVLYSLCKSFDICGRVGGVRKALKLLCTSQNYGV-------------------- 370

  Fly   603 ISALPEATPAQLQAFDDVCAICYQEMYSAKITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYT 665
                 .||..|.....|:||||..|.....|..|:|.|...||..||..:..||||..:.:.|
Human   371 -----RATGQQCTEAGDICAICQAEFREPLILLCQHVFCEECLCLWLDRERTCPLCRSVAVDT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425 44/246 (18%)
zf-rbx1 <618..659 CDD:289448 17/40 (43%)
zf-RING_2 619..659 CDD:290367 17/39 (44%)
RNFT2NP_001103373.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 13..41
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..149
RING-HC_RNFT2 382..422 CDD:319656 17/39 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.