powered by:
Protein Alignment Trc8 and AT4G12190
DIOPT Version :9
Sequence 1: | NP_996303.1 |
Gene: | Trc8 / 43476 |
FlyBaseID: | FBgn0039668 |
Length: | 809 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_192956.1 |
Gene: | AT4G12190 / 826827 |
AraportID: | AT4G12190 |
Length: | 71 |
Species: | Arabidopsis thaliana |
Alignment Length: | 44 |
Identity: | 19/44 - (43%) |
Similarity: | 25/44 - (56%) |
Gaps: | 6/44 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 621 CAICYQEMYSA----KITR--CRHFFHGVCLRKWLYVQDRCPLC 658
|:||.:.:.|. .||| |.|.||..||.:||..::.||||
plant 22 CSICLESLVSGPKPRDITRMTCSHVFHNGCLLEWLKRKNTCPLC 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5243 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.