DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and AT4G12190

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_192956.1 Gene:AT4G12190 / 826827 AraportID:AT4G12190 Length:71 Species:Arabidopsis thaliana


Alignment Length:44 Identity:19/44 - (43%)
Similarity:25/44 - (56%) Gaps:6/44 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 CAICYQEMYSA----KITR--CRHFFHGVCLRKWLYVQDRCPLC 658
            |:||.:.:.|.    .|||  |.|.||..||.:||..::.||||
plant    22 CSICLESLVSGPKPRDITRMTCSHVFHNGCLLEWLKRKNTCPLC 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425
zf-rbx1 <618..659 CDD:289448 19/44 (43%)
zf-RING_2 619..659 CDD:290367 19/44 (43%)
AT4G12190NP_192956.1 RING_Ubox 21..66 CDD:388418 19/44 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.