DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and AT4G05350

DIOPT Version :10

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_192444.1 Gene:AT4G05350 / 825883 AraportID:AT4G05350 Length:206 Species:Arabidopsis thaliana


Alignment Length:44 Identity:18/44 - (40%)
Similarity:25/44 - (56%) Gaps:6/44 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 CAICYQEMYSA----KITR--CRHFFHGVCLRKWLYVQDRCPLC 658
            |:||.:.:.|.    .:||  |.|.||..||.:||..::.||||
plant   157 CSICLESLVSGPKPRDVTRMTCSHVFHNGCLLEWLKRKNTCPLC 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 8..590 CDD:463960
RING-H2_RNF139-like 619..659 CDD:438139 18/44 (41%)
AT4G05350NP_192444.1 RING_Ubox 156..201 CDD:473075 18/44 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.