| Sequence 1: | NP_996303.1 | Gene: | Trc8 / 43476 | FlyBaseID: | FBgn0039668 | Length: | 809 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001093485.1 | Gene: | chfr / 564271 | ZFINID: | ZDB-GENE-030131-3522 | Length: | 637 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 43/202 - (21%) |
|---|---|---|---|
| Similarity: | 62/202 - (30%) | Gaps: | 60/202 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 621 CAICYQEMYSA-KITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTDKADENAPEAEPAPAAQAE 684
Fly 685 QPMRIYPRDDANNAAAQRR--------------SPERA--------------------PVEASEQ 715
Fly 716 APATSSSSAAATIGAEAVSAIVESAAAVGEARSLVSVASSSSATHRISASGSSDSSYMTASAQS- 779
Fly 780 -PPPTAT 785 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Trc8 | NP_996303.1 | TRC8_N | 122..590 | CDD:290425 | |
| zf-rbx1 | <618..659 | CDD:289448 | 11/38 (29%) | ||
| zf-RING_2 | 619..659 | CDD:290367 | 11/38 (29%) | ||
| chfr | NP_001093485.1 | FHA | 10..98 | CDD:238017 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 120..172 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 193..267 | ||||
| RING | 276..319 | CDD:238093 | 12/44 (27%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 428..447 | 8/27 (30%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5243 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||