DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and CHFR

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_001154816.1 Gene:CHFR / 55743 HGNCID:20455 Length:664 Species:Homo sapiens


Alignment Length:223 Identity:49/223 - (21%)
Similarity:75/223 - (33%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 PAQLQAFDDVCAICYQEMYSAKITRCRHFFHGVCLRKWLYVQDR-CPLCHEIMMYTDKADENAPE 674
            |:......|.|.|...|. |.::|.......|..:.|...|:.: |||....::|. ...:|.||
Human    51 PSNKLVSGDHCRIVVDEK-SGQVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYL-VYRKNEPE 113

  Fly   675 AEPA--------------PAAQAEQPMRIYPRDDANNAAAQRRSPERAPVEA-------SEQAPA 718
            ...|              .:.:|.:....:...|.:.|.|.|.:..|.|..:       .|..|:
Human   114 HNVAYLYESLSEKQGMTQESFEANKENVFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPS 178

  Fly   719 TSSSSAAATIGAEAVSAIVESAAAVGEARSLVSVASSSSATHRISASGSSDSSYMTASAQSPPPT 783
            ||:|....|..|.:.     ..:..|..||    :|..|....||..||           .|...
Human   179 TSTSDLFPTASASST-----EPSPAGRERS----SSCGSGGGGISPKGS-----------GPSVA 223

  Fly   784 ATSAAAVATAAASNTTHMFRM--SQDQQ 809
            :...::.|:|.....|..|..  .|||:
Human   224 SDEVSSFASALPDRKTASFSSLEPQDQE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425
zf-rbx1 <618..659 CDD:289448 12/41 (29%)
zf-RING_2 619..659 CDD:290367 12/40 (30%)
CHFRNP_001154816.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
FHA 16..105 CDD:238017 13/54 (24%)
FHA <31..140 CDD:224630 19/90 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..267 30/130 (23%)
RING 303..346 CDD:238093
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..417
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.