DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and Amfr

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:XP_038954087.1 Gene:Amfr / 361367 RGDID:1311551 Length:643 Species:Rattus norvegicus


Alignment Length:333 Identity:81/333 - (24%)
Similarity:118/333 - (35%) Gaps:85/333 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   399 LFYILALQTGLTSLSPDKRFIRLCRNLCLLMTALLHFLHNIV---SPILMSLSAARNPSRKRHVR 460
            :||......|:.::...:..:..|     |..|.|.|||.:|   ......||.:.......|.|
  Rat   126 IFYKFIFIFGVLNVQTVEEVVMWC-----LWFAGLVFLHLMVQLCKDRFEYLSFSPTTPMSSHGR 185

  Fly   461 ALSV--------CAFLVVLSVSLLYHLWSQQSISTWLLAVTAFSVEVVVKVLVSLATYTLFLLDA 517
            .||:        |...||..|:...|     .:.| |..:.|.|:.|.|:....:..|.:.|.|.
  Rat   186 VLSLLIAMLLSCCGLAVVCCVTGYTH-----GMHT-LAFMAAESLLVTVRTAHVILRYVIHLWDL 244

  Fly   518 RRQFFWEKLDDYLYYVRAFGNSVEFCFGILLFINGAWILIFESAQNATGGGIRAIMMCIH--AYF 580
            ..:..||....|:||       .:|...::|       |..:            :|..||  .:.
  Rat   245 NHEGTWEGKGTYVYY-------TDFVMELML-------LSLD------------LMHHIHMLLFG 283

  Fly   581 NIWCEARAGWSVFMKRRSAVHKI------------------SALPEATPAQLQAFDDVCAICYQE 627
            |||. :.|...:||:.|...|::                  :....||..:|...:|.||||:..
  Rat   284 NIWL-SMASLVIFMQLRYLFHEVQRRIRRHKNYLRVVGNMEARFAVATAEELAVNNDDCAICWDS 347

  Fly   628 MYSAKITRCRHFFHGVCLRKWLYVQDRCPLCHEIMMYTD-----------KADENAPEAEPAPAA 681
            |.:|:...|.|.||..|||.||.....||.|...:...|           ..|||.     .|.|
  Rat   348 MQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADGSRAREDHQGENLDENL-----VPVA 407

  Fly   682 QAEQPMRI 689
            .||...|:
  Rat   408 AAEGRPRL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425 46/203 (23%)
zf-rbx1 <618..659 CDD:289448 18/40 (45%)
zf-RING_2 619..659 CDD:290367 18/39 (46%)
AmfrXP_038954087.1 HRD1 86..>382 CDD:227568 72/293 (25%)
RING-H2_AMFR 339..382 CDD:319369 19/42 (45%)
CUE_AMFR 458..498 CDD:270604
G2BR 575..600 CDD:375868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.