DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trc8 and dsc1

DIOPT Version :9

Sequence 1:NP_996303.1 Gene:Trc8 / 43476 FlyBaseID:FBgn0039668 Length:809 Species:Drosophila melanogaster
Sequence 2:NP_595266.2 Gene:dsc1 / 2541251 PomBaseID:SPBC947.10 Length:695 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:43/216 - (19%)
Similarity:73/216 - (33%) Gaps:82/216 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 YHLWSQQSIS----------TWLLAVTAFSVEVVVKVLVSLATYTLFLLDARRQFFWEKLDDYLY 531
            |..|..|.|.          ||...:.|    .|:::.:.||.:               :|..| 
pombe   521 YSFWIPQIIQNVKQGTSRSFTWTYILGA----SVLRLYLPLAIF---------------IDSEL- 565

  Fly   532 YVRAFGNSVEFCFGILLFINGAWILIFESAQNATGGGIRAIMMCIHAYFNIWCEARAGWSVFMKR 596
             :..|.....|..|::|     |:|            .:.:::.:        :...|...|:.:
pombe   566 -ILGFPPKYFFALGLVL-----WML------------FQVLVLLV--------QDTLGPRFFLPK 604

  Fly   597 R----SAVHKISALPEATPAQLQAF---DDVCAICYQ--EMYSA---------------KITRCR 637
            :    |.|:...  |......|:||   .:||.||.|  |:.|.               .:|.|.
pombe   605 KFFLSSPVYDYH--PVIQQDDLEAFMRDANVCPICMQPIELVSTGSTLNPASMMVRRNYMLTPCH 667

  Fly   638 HFFHGVCLRKWLYVQDRCPLC 658
            |.:|..||.:|:..:..||:|
pombe   668 HLYHRQCLLQWMETRSICPVC 688

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trc8NP_996303.1 TRC8_N 122..590 CDD:290425 18/122 (15%)
zf-rbx1 <618..659 CDD:289448 17/58 (29%)
zf-RING_2 619..659 CDD:290367 17/57 (30%)
dsc1NP_595266.2 zf-RING_2 632..689 CDD:290367 17/57 (30%)
zf-rbx1 <633..689 CDD:289448 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.