DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and RAD7

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_012586.1 Gene:RAD7 / 853512 SGDID:S000003813 Length:565 Species:Saccharomyces cerevisiae


Alignment Length:398 Identity:84/398 - (21%)
Similarity:150/398 - (37%) Gaps:94/398 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ICRLARICRRWRQIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLISVR----------------- 101
            |.:::....:|::.|.::.......||..:.|:...:|..|.:.:|..                 
Yeast   173 ITKISENISKWQKEADESSKLVFNKLRDVLGGVSTANLNNLAKALSKNRALNDHTLQLFLKTDLK 237

  Fly   102 --------------------FGPTLRYIELPIEL---ITHTVLHELSAKCPNLTHMLLD------ 137
                                |.|.|  .||.:::   :.|..|..::.|.|||..:.||      
Yeast   238 RLTFSDCSKISFDGYKTLAIFSPHL--TELSLQMCGQLNHESLLYIAEKLPNLKSLNLDGPFLIN 300

  Fly   138 ------FSTAM--QLHDF--SEMQAFPTK-LRYMCVCLSEVIFMEGFMR--KIYNFINGLEVLHL 189
                  |...|  :|.:|  |....|..| |..:.:.....:...|..|  .|.|:  .|...:|
Yeast   301 EDTWEKFFVIMKGRLEEFHISNTHRFTDKSLSNLLINCGSTLVSLGLSRLDSISNY--ALLPQYL 363

  Fly   190 IGT--YEKCEE---EEEEIYEVINVHKLKSATPNLRVINLYGINFIDDSHI----DAFSSNCIQL 245
            :..  :..|.|   .||::.:.|.::.|......||.:.|.|...:.||.|    .||......|
Yeast   364 VNDEFHSLCIEYPFNEEDVNDEIIINLLGQIGRTLRKLVLNGCIDLTDSMIINGLTAFIPEKCPL 428

  Fly   246 ECLAVNFCNKVTGST---------LKTLIQRSKRLTCLLMNGTSLKSEFVMQAEWDKCALQELDI 301
            |.|::...:::|..:         |..||:.|.| .||.:...:: .|.::....|  :|:.|::
Yeast   429 EVLSLEESDQITTDSLSYFFSKVELNNLIECSFR-RCLQLGDMAI-IELLLNGARD--SLRSLNL 489

  Fly   302 TA-TDLSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESGTTRSLISLDLDSSDNISDEGL 365
            .: .:|:.|..|.:  ..|:|.:|..|.:...:|||::...|.....::|.:   ..||:..|  
Yeast   490 NSLKELTKEAFVAL--ACPNLTYLDLGFVRCVDDSVIQMLGEQNPNLTVIDV---FGDNLVTE-- 547

  Fly   366 LKFIQRQG 373
             |...|.|
Yeast   548 -KATMRPG 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 3/25 (12%)
leucine-rich repeat 131..156 CDD:275381 9/40 (23%)
leucine-rich repeat 157..175 CDD:275381 2/17 (12%)
leucine-rich repeat 219..244 CDD:275381 9/28 (32%)
leucine-rich repeat 245..270 CDD:275381 8/33 (24%)
leucine-rich repeat 271..295 CDD:275381 4/23 (17%)
leucine-rich repeat 296..320 CDD:275381 5/24 (21%)
leucine-rich repeat 321..348 CDD:275381 7/26 (27%)
leucine-rich repeat 349..375 CDD:275381 7/25 (28%)
leucine-rich repeat 376..403 CDD:275381
leucine-rich repeat 405..432 CDD:275381
RAD7NP_012586.1 AMN1 228..440 CDD:187754 45/215 (21%)
leucine-rich repeat 236..261 CDD:275381 1/24 (4%)
leucine-rich repeat 262..287 CDD:275381 6/26 (23%)
leucine-rich repeat 288..340 CDD:275381 11/51 (22%)
leucine-rich repeat 342..365 CDD:275381 6/24 (25%)
leucine-rich repeat 368..397 CDD:275381 6/28 (21%)
leucine-rich repeat 398..426 CDD:275381 9/27 (33%)
leucine-rich repeat 428..455 CDD:275381 5/26 (19%)
leucine-rich repeat 456..475 CDD:275381 6/20 (30%)
leucine-rich repeat 484..507 CDD:275381 5/24 (21%)
leucine-rich repeat 508..533 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.