DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FipoQ and AMN1

DIOPT Version :9

Sequence 1:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster
Sequence 2:NP_009716.1 Gene:AMN1 / 852455 SGDID:S000000362 Length:549 Species:Saccharomyces cerevisiae


Alignment Length:445 Identity:86/445 - (19%)
Similarity:157/445 - (35%) Gaps:101/445 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GQLAVEASQVYLSDGTVRSPFADTTIEKLPDKVLLHIFSYLSHREICRLARIC--RRWR------ 65
            |...||..:..||..|.:| |..::::..|:|...:  .|||..|...|....  ..|.      
Yeast    66 GSSKVELVRPDLSLKTDQS-FLQSSVQTTPNKKSCN--EYLSTPEATPLKNTATENAWATSRVVS 127

  Fly    66 ----QIAYDTRLWKNVSLRPEVSGLHVGSLEMLLQLISVRFGPTLRYIELP--IELITHTVLHEL 124
                .|...|.: ||: |..|.|.|.:|      |.::.:...:....|:|  :|.|...::...
Yeast   128 ASSLSIVTPTEI-KNI-LVDEFSELKLG------QPLTAQHQRSHAVFEIPEIVENIIKMIVSLE 184

  Fly   125 SAKCP-----------NLTHMLLDF----------STAMQLHDFSEMQAFPTKLR---YMCVCLS 165
            ||..|           :..|.||.:          |.|.||.| ..:.....|.:   :.|:.::
Yeast   185 SANIPKERPCLRRNPQSYEHSLLMYKDEERAKKAWSAAQQLRD-PPLVGHKEKKQGALFSCMMVN 248

  Fly   166 EV--------IFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEEIYEVIN-----VHKLKSAT- 216
            .:        :|.....:.::||...|..             .:|..:|:.     :|||...| 
Yeast   249 RLWLNVTRPFLFKSLHFKSVHNFKEFLRT-------------SQETTQVMRPSHFILHKLHQVTQ 300

  Fly   217 PNLRVINLYGINFIDDSHIDAFSSNCIQLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLMNGT-S 280
            |::..::               ...|..|:.|....|.::|...  :......:|..|::.|. :
Yeast   301 PDIERLS---------------RMECQNLKWLEFYVCPRITPPL--SWFDNLHKLEKLIIPGNKN 348

  Fly   281 LKSEFVMQAEWDKCALQELDITATD-LSTECLVDMLSRIPSLKFLSAGQINGFNDSVLKQWMESG 344
            :...|:::.......|:.|.:.|.| :|...:|.:....|.||..:.|:....|.......:..|
Yeast   349 IDDNFLLRLSQSIPNLKHLVLRACDNVSDSGVVCIALNCPKLKTFNIGRHRRGNLITSVSLVALG 413

  Fly   345 TTRSLISLDLDSSDNISDEGLLKFIQRQGHQLSACCLSGMPHITDQLWMSILPLL 399
            ....:.::.....| :.|.|:.:|.:..|..:....|:....:||.    .||:|
Yeast   414 KYTQVETVGFAGCD-VDDAGIWEFARLNGKNVERLSLNSCRLLTDY----SLPIL 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 12/57 (21%)
leucine-rich repeat 131..156 CDD:275381 8/34 (24%)
leucine-rich repeat 157..175 CDD:275381 2/28 (7%)
leucine-rich repeat 219..244 CDD:275381 1/24 (4%)
leucine-rich repeat 245..270 CDD:275381 4/24 (17%)
leucine-rich repeat 271..295 CDD:275381 4/24 (17%)
leucine-rich repeat 296..320 CDD:275381 6/24 (25%)
leucine-rich repeat 321..348 CDD:275381 5/26 (19%)
leucine-rich repeat 349..375 CDD:275381 5/25 (20%)
leucine-rich repeat 376..403 CDD:275381 6/24 (25%)
leucine-rich repeat 405..432 CDD:275381
AMN1NP_009716.1 AMN1 285..509 CDD:187754 37/201 (18%)
leucine-rich repeat 314..337 CDD:275381 4/24 (17%)
leucine-rich repeat 338..363 CDD:275381 4/24 (17%)
leucine-rich repeat 364..389 CDD:275381 6/24 (25%)
leucine-rich repeat 390..417 CDD:275381 5/26 (19%)
leucine-rich repeat 418..443 CDD:275381 5/25 (20%)
leucine-rich repeat 444..471 CDD:275381 6/24 (25%)
leucine-rich repeat 472..493 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.